Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX8UF9J)

• DOT Name: Cell division cycle-associated protein 2 (CDCA2)
• Synonyms: Recruits PP1 onto mitotic chromatin at anaphase protein; Repo-Man
• Gene Name: CDCA2
• Related Disease:
  Hepatocellular carcinoma
  Colorectal carcinoma
  Melanoma
  Neuroblastoma
  Squamous cell carcinoma
  Advanced cancer
  Bladder cancer
  Lung adenocarcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
• UniProt ID: CDCA2_HUMAN
• PDB ID: 5INB; 5IOH; 5SW9
• Pfam ID: PF15276
• Sequence:
  MDANSKDKPPETKESAMNNAGNASFILGTGKIVTPQKHAELPPNPCTPDTFKSPLNFSTV
  TVEQLGITPESFVRNSAGKSSSYLKKCRRRSAVGARGSPETNHLIRFIARQQNIKNARKS
  PLAQDSPSQGSPALYRNVNTLRERISAFQSAFHSIKENEKMTGCLEFSEAGKESEMTDLT
  RKEGLSACQQSGFPAVLSSKRRRISYQRDSDENLTDAEGKVIGLQIFNIDTDRACAVETS
  VDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADCVVGKGSSDAVSPDTFTAEVS
  SDAVPDVRSPATPACRRDLPTPKTFVLRSVLKKPSVKMCLESLQEHCNNLYDDDGTHPSL
  ISNLPNCCKEKEAEDEENFEAPAFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTP
  VCKKDFSGLSSLLLEQSPVPEPLPQPDFDDKGENLENIEPLQVSFAVLSSPNKSSISETL
  SGTDTFSSSNNHEKISSPKVGRITRTSNRRNQLVSVVEESVCNLLNTEVQPCKEKKINRR
  KSQETKCTKRALPKKSQVLKSCRKKKGKGKKSVQKSLYGERDIASKKPLLSPIPELPEVP
  EMTPSIPSIRRLGSGYFSSNGKLEEVKTPKNPVKRKDLLRHDPDLHMHQGYDKYDVSEFC
  SYIKSSSSLGNATSDEDPNTNIMNINENKNIPKAKNKSESENEPKAGTDSPVSCASVTEE
  RVASDSPKPALTLQQGQEFSAGGQNAENLCQFFKISPDLNIKCERKDDFLGAAEGKLQCN
  RLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGR
  SLHLEKNGNHTPSSSVGSSVEISLENSELFKDLSDAIEQTFQRRNSETKVRRSTRLQKDL
  ENEGLVWISLPLPSTSQKAKRRTICTFDSSGFESMSPIKETVSSRQKPQMAPPVSDPENS
  QGPAAGSSDEPGKRRKSFCISTLANTKATSQFKGYRRRSSLNGKGESSLTALERIEHNGE
  RKQ
• Function: Regulator of chromosome structure during mitosis required for condensin-depleted chromosomes to retain their compact architecture through anaphase. Acts by mediating the recruitment of phopsphatase PP1-gamma subunit (PPP1CC) to chromatin at anaphase and into the following interphase. At anaphase onset, its association with chromatin targets a pool of PPP1CC to dephosphorylate substrates.
• Tissue Specificity: Ubiquitously expressed.

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Definitive	Biomarker	[1]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[2]
Melanoma	DIS1RRCY	Strong	Altered Expression	[3]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[4]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[4]
Bladder cancer	DISUHNM0	moderate	Altered Expression	[5]
Lung adenocarcinoma	DISD51WR	moderate	Altered Expression	[2]
Urinary bladder cancer	DISDV4T7	moderate	Altered Expression	[5]
Urinary bladder neoplasm	DIS7HACE	moderate	Altered Expression	[5]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[6]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[7]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[8]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cell division cycle-associated protein 2 (CDCA2).	[9]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[10]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[11]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Cell division cycle-associated protein 2 (CDCA2).	[12]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Cell division cycle-associated protein 2 (CDCA2).	[13]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Cell division cycle-associated protein 2 (CDCA2).	[14]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[15]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[16]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[15]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Cell division cycle-associated protein 2 (CDCA2).	[12]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[17]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[1]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[19]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[20]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[21]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[22]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[23]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[23]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Cell division cycle-associated protein 2 (CDCA2).	[24]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[25]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[26]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[28]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Cell division cycle-associated protein 2 (CDCA2).	[30]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[31]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Cell division cycle-associated protein 2 (CDCA2).	[32]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Cell division cycle-associated protein 2 (CDCA2).	[33]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Cell division cycle-associated protein 2 (CDCA2).	[27]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Cell division cycle-associated protein 2 (CDCA2).	[29]

References

• [1] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [2] CDCA2 promotes the proliferation of colorectal cancer cells by activating the AKT/CCND1 pathway in vitro and in vivo.BMC Cancer. 2019 Jun 13;19(1):576. doi: 10.1186/s12885-019-5793-z.
• [3] Comprehensive expression profiling of tumor cell lines identifies molecular signatures of melanoma progression.PLoS One. 2007 Jul 4;2(7):e594. doi: 10.1371/journal.pone.0000594.
• [4] CDCA2 promotes lung adenocarcinoma cell proliferation and predicts poor survival in lung adenocarcinoma patients.Oncotarget. 2017 Mar 21;8(12):19768-19779. doi: 10.18632/oncotarget.15519.
• [5] Dual strands of the miR-223 duplex (miR-223-5p and miR-223-3p) inhibit cancer cell aggressiveness: targeted genes are involved in bladder cancer pathogenesis.J Hum Genet. 2018 May;63(5):657-668. doi: 10.1038/s10038-018-0437-8. Epub 2018 Mar 14.
• [6] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [7] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [8] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [9] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [10] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [11] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [12] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [13] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [14] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [15] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [16] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [17] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [18] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [19] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [20] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [21] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [22] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [23] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [24] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [25] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [26] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [27] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [28] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [29] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [30] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [31] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [32] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [33] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.