Details of the Drug

General Information of Drug (ID: DM8ANCF)

Drug Name

Muromonab

Indication

Disease Entry	ICD 11	Status	REF
Organ transplant rejection	NE84	Approved	[1]

Therapeutic Class

Immunomodulatory Agents

Sequence

>light chain
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAH
FRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEINRADTAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
>heavy chain
QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNY
NQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSA
KTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK

ADMET Property

Half-life: The concentration or amount of drug in body reduced by one-half in 0.8 hours [2]
Metabolism: The drug is metabolized via opsonization via the reticuloendothelial system [3]

Cross-matching ID

DrugBank ID: DB00075
TTD ID: D0C6PS

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
T-cell surface glycoprotein CD3 epsilon (CD3E)	TTZAT79	CD3E_HUMAN	Binder	[4]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease

Organ transplant rejection

ICD Disease Classification

NE84

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
T-cell surface glycoprotein CD3 epsilon (CD3E)	DTT	CD3E	1.53E-06	-0.93	-1.37

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Muromonab

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Disease	REF
Azathioprine	DMMZSXQ	Moderate	Additive immunosuppressive effects by the combination of Muromonab and Azathioprine.	Transplant rejection [NE84]	[9]
-----------

Coadministration of a Drug Treating the Disease Different from Muromonab (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Roflumilast	DMPGHY8	Moderate	Additive immunosuppressive effects by the combination of Muromonab and Roflumilast.	Asthma [CA23]	[10]
Teriflunomide	DMQ2FKJ	Major	Additive immunosuppressive effects by the combination of Muromonab and Teriflunomide.	Hyper-lipoproteinaemia [5C80]	[11]
Polyethylene glycol	DM4I1JP	Moderate	Increased risk of lowers seizure threshold by the combination of Muromonab and Polyethylene glycol.	Irritable bowel syndrome [DD91]	[12]
Denosumab	DMNI0KO	Moderate	Additive immunosuppressive effects by the combination of Muromonab and Denosumab.	Low bone mass disorder [FB83]	[13]
Cladribine	DM3JDRP	Major	Additive immunosuppressive effects by the combination of Muromonab and Cladribine.	Mature B-cell leukaemia [2A82]	[10]
Alemtuzumab	DMZL3IV	Moderate	Additive immunosuppressive effects by the combination of Muromonab and Alemtuzumab.	Mature B-cell leukaemia [2A82]	[14]
Tecfidera	DM2OVDT	Moderate	Additive immunosuppressive effects by the combination of Muromonab and Tecfidera.	Multiple sclerosis [8A40]	[15]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Muromonab and Siponimod.	Multiple sclerosis [8A40]	[9]
Fingolimod	DM5JVAN	Major	Additive immunosuppressive effects by the combination of Muromonab and Fingolimod.	Multiple sclerosis [8A40]	[16]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Muromonab and Ocrelizumab.	Multiple sclerosis [8A40]	[17]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Muromonab and Ozanimod.	Multiple sclerosis [8A40]	[10]
Omacetaxine mepesuccinate	DMPU2WX	Moderate	Additive immunosuppressive effects by the combination of Muromonab and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[18]
Bupropion	DM5PCS7	Major	Increased risk of lowers seizure threshold by the combination of Muromonab and Bupropion.	Nicotine use disorder [6C4A]	[19]
Tramadol	DMRQD04	Major	Increased risk of lowers seizure threshold by the combination of Muromonab and Tramadol.	Pain [MG30-MG3Z]	[20]
Lindane	DMB8CNL	Moderate	Increased risk of lowers seizure threshold by the combination of Muromonab and Lindane.	Pediculosis [1G00]	[21]
Canakinumab	DM8HLO5	Moderate	Additive immunosuppressive effects by the combination of Muromonab and Canakinumab.	Rheumatoid arthritis [FA20]	[22]
Rilonacept	DMGLUQS	Moderate	Additive immunosuppressive effects by the combination of Muromonab and Rilonacept.	Rheumatoid arthritis [FA20]	[22]
Golimumab	DMHZV7X	Major	Additive immunosuppressive effects by the combination of Muromonab and Golimumab.	Rheumatoid arthritis [FA20]	[23]
Leflunomide	DMR8ONJ	Major	Additive immunosuppressive effects by the combination of Muromonab and Leflunomide.	Rheumatoid arthritis [FA20]	[11]
Anthrax vaccine	DM9GSWY	Moderate	Antagonize the effect of Muromonab when combined with Anthrax vaccine.	Sepsis [1G40-1G41]	[24]
-----------


⏷ Show the Full List of 20 DDI Information of This Drug

References

1	Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
2	Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
3	FDA approval: ado-trastuzumab emtansine for the treatment of patients with HER2-positive metastatic breast cancer. Clin Cancer Res. 2014 Sep 1;20(17):4436-41.
4	Basiliximab: a review of its use as induction therapy in renal transplantation. Drugs. 2003;63(24):2803-35.
5	Trifunctional antibody ertumaxomab: Non-immunological effects on Her2 receptor activity and downstream signaling. MAbs. 2012 Sep-Oct;4(5):614-22.
6	Resimmune, an anti-CD3 recombinant immunotoxin, induces durable remissions in patients with cutaneous T-cell lymphoma.Haematologica.2015 Jun;100(6):794-800.
7	EpCAM/CD3-Bispecific T-cell engaging antibody MT110 eliminates primary human pancreatic cancer stem cells. Clin Cancer Res. 2012 Jan 15;18(2):465-74.
8	Antitumor activities of PSMA CD3 diabodies by redirected T-cell lysis of prostate cancer cells. Immunotherapy. 2013 Jan;5(1):27-38.
9	Cerner Multum, Inc. "Australian Product Information.".
10	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
11	Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
12	Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA.
13	Product Information. Lonsurf (tipiracil-trifluridine). Taiho Oncology, Inc., Princeton, NJ.
14	Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
15	Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
16	Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
17	Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
18	Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
19	Sheehan DV, Welch JB, Fishman SM "A case of bupropion-induced seizure." J Nerv Ment Dis 174 (1986): 496-8. [PMID: 3090199]
20	Product Information. Ultram (tramadol). McNeil Pharmaceutical, Raritan, NJ.
21	Matsuoka LY "Convulsions following application of gamma benzene hexachloride." J Am Acad Dermatol 5 (1981): 98-9. [PMID: 6168673]
22	Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
23	Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
24	CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]