Details of the Drug-Related molecule(s) Interaction Atlas

General Information of Drug (ID: DMP9TWZ)

Drug Name
Corticotropin Drug Info
Synonyms
corticotropin; ACTH; Cortrophin; Corticotrophin; Adrenocorticotropic hormone; Corticotrophine; Corticotrofina; Acthargel; Corticotrophinum; beta-Corticotropin; Adrenocorticotrophin; Purified Cortrophin gel; Corticotropin [USP:INN]; 9002-60-2; CHEBI:3892; BDBM82408; ACTH-(1-39); 25-Asp-30-Gln-corticotropin porcine; NCGC00167127-01; CAS_12279-41-3; Adrenocorticotropic Hormone (1-39), human; LS-187380; SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF; J-004856; alpha1-39-Corticotropin (swine), 25-L-aspartic acid-30-L-glutamine
Indication
Disease Entry ICD 11 Status REF
Cushing disease 5A70 Approved [1]
Diabetic nephropathy GB61.Z Approved [2]
West syndrome Approved [3]
Cross-matching ID
PubChem CID
16132265
ChEBI ID
CHEBI:3892
CAS Number
CAS 12427-33-7
TTD Drug ID
DMP9TWZ
INTEDE Drug ID
DR0383

Molecule-Related Drug Atlas

Molecule-Related Drug Atlas
Molecule Type:
DME
DOT
Drug Status:
Approved Drug(s)
Download the Complete Related Drug List
Drug(s) Metabolized By Cytochrome P450 3A4 (CYP3A4)
Drug Name Drug ID Indication ICD 11 Highest Status REF
Doxorubicin DMVP5YE Acute myelogenous leukaemia 2A41 Approved [8]
Progesterone DMUY35B Amenorrhea GA20.0 Approved [9]
Tamoxifen DMLB0EZ Breast cancer 2C60-2C65 Approved [10]
Estradiol DMUNTE3 Acne vulgaris ED80 Approved [11]
Acetaminophen DMUIE76 Allergic rhinitis CA08.0 Approved [12]
Imatinib DM7RJXL Acute lymphoblastic leukaemia 2A85 Approved [13]
Etoposide DMNH3PG Acute myelogenous leukaemia 2A41 Approved [14]
Zidovudine DM4KI7O Human immunodeficiency virus infection 1C62 Approved [15]
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [9]
Verapamil DMA7PEW Angina pectoris BA40 Approved [16]
⏷ Show the Full List of 10 Drug(s)
Drug(s) Affected By Adenosine deaminase (ADA)
Drug Name Drug ID Indication ICD 11 Highest Status REF
Fulvestrant DM0YZC6 Breast cancer 2C60-2C65 Approved [17]
Quercetin DM3NC4M Obesity 5B81 Approved [18]
Tretinoin DM49DUI Acne vulgaris ED80 Approved [19]
Zidovudine DM4KI7O Human immunodeficiency virus infection 1C62 Approved [20]
Panobinostat DM58WKG Chronic graft versus host disease Approved [21]
Ciclosporin DMAZJFX Graft-versus-host disease 4B24 Approved [22]
Valproate DMCFE9I Epilepsy 8A60-8A68 Approved [23]
Rosiglitazone DMILWZR Chronic kidney disease GB61 Approved [24]
Temozolomide DMKECZD Adenocarcinoma 2D40 Approved [25]
Decitabine DMQL8XJ Acute myelogenous leukaemia 2A41 Approved [26]
⏷ Show the Full List of 10 Drug(s)
Drug(s) Affected By Glucocorticoid receptor (NR3C1)
Drug Name Drug ID Indication ICD 11 Highest Status REF
Estradiol DMUNTE3 Acne vulgaris ED80 Approved [27]
Fulvestrant DM0YZC6 Breast cancer 2C60-2C65 Approved [28]
Hydrogen peroxide DM1NG5W Infectious disease 1A00-CA43.1 Approved [29]
Selenium DM25CGV N. A. N. A. Approved [30]
Colchicine DM2POTE Acute gout flare FA25.0 Approved [31]
Methotrexate DM2TEOL Anterior urethra cancer Approved [32]
Quercetin DM3NC4M Obesity 5B81 Approved [18]
Troglitazone DM3VFPD Diabetic complication 5A2Y Approved [33]
Tretinoin DM49DUI Acne vulgaris ED80 Approved [34]
Zidovudine DM4KI7O Human immunodeficiency virus infection 1C62 Approved [35]
⏷ Show the Full List of 10 Drug(s)
Drug(s) Affected By Steroid 17-alpha-hydroxylase/17,20 lyase (CYP17A1)
Drug Name Drug ID Indication ICD 11 Highest Status REF
Etretinate DM2CZFA Keratosis ED56 Approved [36]
FADROZOLE DM3C5GZ Breast cancer 2C60-2C65 Approved [37]
Troglitazone DM3VFPD Diabetic complication 5A2Y Approved [38]
Tretinoin DM49DUI Acne vulgaris ED80 Approved [39]
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [40]
Testosterone DM7HUNW Hot flushes GA30 Approved [40]
Pyruvic acid DM7Q41G Malnutrition 5B50-5B71 Approved [41]
Topiramate DM82Z30 Alcohol dependence 6C40.2 Approved [42]
Lamotrigine DM8SXYG Bipolar disorder 6A60 Approved [42]
ABIRATERONE DM8V75C Prostate cancer 2C82.0 Approved [43]
⏷ Show the Full List of 10 Drug(s)

Molecular Interaction Atlas of This Drug

Molecular Interaction Atlas
Download the Complete Interaction Atlas for Visualization in Cytoscape

Drug-Metabolizing Enzyme (DME)
DME Name DME ID UniProt ID MOA REF
Cytochrome P450 3A4 (CYP3A4) Main DME DE4LYSA CP3A4_HUMAN Substrate [4]

Drug Off-Target (DOT)
DOT Name DOT ID UniProt ID Interaction REF
Adenosine deaminase (ADA) OTOX2872 ADA_HUMAN Gene/Protein Processing [5]
Glucocorticoid receptor (NR3C1) OTCI2YDI GCR_HUMAN Regulation of Drug Effects [6]
Steroid 17-alpha-hydroxylase/17,20 lyase (CYP17A1) OTZKVLVJ CP17A_HUMAN Regulation of Drug Effects [7]

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3633).
2 ClinicalTrials.gov (NCT01939132) Protocol for H.P. Acthar Gel in Moderately to Severely Active Psoriatic Arthritis. U.S. National Institutes of Health.
3 Corticotropin FDA Label
4 Troglitazone induces CYP3A4 activity leading to falsely abnormal dexamethasone suppression test. J Clin Endocrinol Metab. 2003 Jul;88(7):3113-6.
5 Activity of adenosine deaminase in red blood cells of patients suffering from multiple sclerosis treated with adrenocorticotropic hormone. Pol J Pharmacol. 1995 Nov-Dec;47(6):525-30.
6 Sex specific associations between common glucocorticoid receptor gene variants and hypothalamus-pituitary-adrenal axis responses to psychosocial stress. Biol Psychiatry. 2007 Oct 15;62(8):863-9. doi: 10.1016/j.biopsych.2007.04.013. Epub 2007 Aug 23.
7 Partial 17alpha-hydroxylase/17,20-lyase deficiency-clinical report of five Chinese 46,XX cases. Gynecol Endocrinol. 2008 Jul;24(7):362-7. doi: 10.1080/09513590802194051.
8 Expression levels and activation of a PXR variant are directly related to drug resistance in osteosarcoma cell lines. Cancer. 2007 Mar 1;109(5):957-65.
9 Contribution of human hepatic cytochrome P450 isoforms to regioselective hydroxylation of steroid hormones. Xenobiotica. 1998 Jun;28(6):539-47.
10 Comprehensive evaluation of tamoxifen sequential biotransformation by the human cytochrome P450 system in vitro: prominent roles for CYP3A and CYP2D6. J Pharmacol Exp Ther. 2004 Sep;310(3):1062-75.
11 Isoform-specific regulation of cytochromes P450 expression by estradiol and progesterone. Drug Metab Dispos. 2013 Feb;41(2):263-9.
12 Metabolic interactions between acetaminophen (paracetamol) and two flavonoids, luteolin and quercetin, through in-vitro inhibition studies. J Pharm Pharmacol. 2017 Dec;69(12):1762-1772.
13 Potent mechanism-based inhibition of CYP3A4 by imatinib explains its liability to interact with CYP3A4 substrates. Br J Pharmacol. 2012 Apr;165(8):2787-98.
14 Effects of morin on the pharmacokinetics of etoposide in rats. Biopharm Drug Dispos. 2007 Apr;28(3):151-6.
15 The metabolism of zidovudine by human liver microsomes in vitro: formation of 3'-amino-3'-deoxythymidine. Biochem Pharmacol. 1994 Jul 19;48(2):267-76.
16 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
17 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
18 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
19 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
20 Enhancement of erythrocytic adenosine deaminase following treatment of AIDS-related complex/AIDS patients with zidovudine. AIDS. 1990 Aug;4(8):799-802. doi: 10.1097/00002030-199008000-00012.
21 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
22 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
23 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
24 PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
25 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
26 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
27 Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
28 Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
29 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
30 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
31 Comparative effects of microtubules disruption on glucocorticoid receptor functions in proliferating and quiescent cells. Int J Toxicol. 2010 May-Jun;29(3):326-35. doi: 10.1177/1091581810366486.
32 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
33 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
34 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
35 Adipocyte differentiation, mitochondrial gene expression and fat distribution: differences between zidovudine and tenofovir after 6 months. Antivir Ther. 2009;14(8):1089-100. doi: 10.3851/IMP1457.
36 Retinoids and retinol differentially regulate steroid biosynthesis in ovarian theca cells isolated from normal cycling women and women with polycystic ovary syndrome. J Clin Endocrinol Metab. 2005 Aug;90(8):4858-65. doi: 10.1210/jc.2005-0330. Epub 2005 May 24.
37 Synthesis and evaluation of (pyridylmethylene)tetrahydronaphthalenes/-indanes and structurally modified derivatives: potent and selective inhibitors of aldosterone synthase. J Med Chem. 2005 Mar 10;48(5):1563-75.
38 Cinnamic acid based thiazolidinediones inhibit human P450c17 and 3beta-hydroxysteroid dehydrogenase and improve insulin sensitivity independent of PPARgamma agonist activity. J Mol Endocrinol. 2004 Apr;32(2):425-36.
39 Use of organ culture to study the human fetal testis development: effect of retinoic acid. J Clin Endocrinol Metab. 2006 Jul;91(7):2696-703.
40 Inhibition of CYP17 expression by adrenal androgens and transforming growth factor beta in adrenocortical cells. Acta Biochim Pol. 2004;51(4):907-17.
41 Phosphorylation of CtBP1 by cAMP-dependent protein kinase modulates induction of CYP17 by stimulating partnering of CtBP1 and 2. J Biol Chem. 2008 Mar 14;283(11):6925-34. doi: 10.1074/jbc.M708432200. Epub 2008 Jan 9.
42 Effects of anticonvulsants on human p450c17 (17alpha-hydroxylase/17,20 lyase) and 3beta-hydroxysteroid dehydrogenase type 2. Epilepsia. 2005 Mar;46(3):444-8.
43 A fission yeast-based test system for the determination of IC50 values of anti-prostate tumor drugs acting on CYP21. J Enzyme Inhib Med Chem. 2006 Oct;21(5):547-56.