Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE4LYSA)

• DME Name: Cytochrome P450 3A4 (CYP3A4)
• Synonyms: Cytochrome P450 family 3 subfamily A member 4; Quinine 3-monooxygenase; 1,4-cineole 2-exo-monooxygenase; 1,8-cineole 2-exo-monooxygenase; Albendazole monooxygenase (sulfoxide-forming); Albendazole sulfoxidase; CYP3A3; CYP3A4; CYPIIIA3; CYPIIIA4; Cholesterol 25-hydroxylase; Cytochrome P450 3A3; Cytochrome P450 HLp; Cytochrome P450 NF-25; Cytochrome P450-PCN1; Nifedipine oxidase
• Gene Name: CYP3A4
• UniProt ID: CP3A4_HUMAN
• INTEDE ID: DME0001
• Gene ID: 1576
• EC Number:
  EC: 1.14.14.55
  Oxidoreductase
  Oxygen paired donor oxidoreductase
  Flavin/flavoprotein donor oxidoreductase
  EC: 1.14.14.55
• Lineage:
  Species: Homo sapiens
  Kingdom: Metazoa
  Phylum: Chordata
  Class: Mammalia
  Order: Primates
  Family: Hominidae
  Genus: Homo
  Species: Homo sapiens
• Sequence:
  MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMF
  DMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
  AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS
  MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV
  FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
  IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
  NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS
  KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG
  GLLQPEKPVVLKVESRDGTVSGA
• Function: This enzyme is involved in the metabolism of sterols, steroid hormones, retinoids and fatty acids. It exhibits high catalytic activity for the formation of hydroxyestrogens from estrone (E1) and 17beta- estradiol (E2), namely 2-hydroxy E1 and E2, as well as D-ring hydroxylated E1 and E2 at the C-16 position and plays a role in the metabolism of androgens, particularly in oxidative deactivation of testosterone. It also metabolizes testosterone to less biologically active 2beta- and 6beta- hydroxytestosterones. It catalyzes bisallylic hydroxylation of polyunsaturated fatty acids (PUFA) and the epoxidation of double bonds of PUFA with a preference for the last double bond. It metabolizes endocannabinoid arachidonoylethanolamide (anandamide) to 8,9-, 11,12-, and 14,15- epoxyeicosatrienoic acid ethanolamides (EpETrE-EAs) and plays a role in the metabolism of retinoids.In addition, it displays high catalytic activity for oxidation of all-trans-retinol to all-trans-retinal, a rate- limiting step for the biosynthesis of all-trans-retinoic acid (atRA) and further metabolizes atRA toward 4-hydroxyretinoate and may play a role in hepatic atRA clearance. It is also responsible for oxidative metabolism of xenobiotics. It metabolizes the majority of the administered drugs; catalyzes sulfoxidation of the anthelmintics albendazole and fenbendazole and hydroxylates antimalarial drug quinine.
• KEGG Pathway:
  Bile secretion (hsa04976)
  Chemical carcinogenesis (hsa05204)
  Drug metabolism - cytochrome P450 (hsa00982)
  Drug metabolism - other enzymes (hsa00983)
  Linoleic acid metabolism (hsa00591)
  Metabolic pathways (hsa01100)
  Metabolism of xenobiotics by cytochrome P450 (hsa00980)
  Retinol metabolism (hsa00830)
  Steroid hormone biosynthesis (hsa00140)
• Reactome Pathway:
  Biosynthesis of maresin-like SPMs (R-HSA-9027307)
  Xenobiotics (R-HSA-211981)
  Aflatoxin activation and detoxification (R-HSA-5423646)

Molecular Interaction Atlas (MIA) of This DME

635 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Abiraterone acetate	DMANBZI	Prostate cancer	2C82.0	Approved	[27]
Acalabrutinib	DM7GCVW	Mantle cell lymphoma	2A85.5	Approved	[28]
Acenocoumarol	DMH75KV	Thrombosis	DB61-GB90	Approved	[29]
Acetaminophen	DMUIE76	Pain	MG30-MG3Z	Approved	[30]
Adinazolam	DMBHO9Y	Anxiety disorder	6B00-6B0Z	Approved	[31]
Albendazole	DMYZ57N	Worm infection	1F90.Z	Approved	[32]
Alclometasone	DMAE84F	Inflammation	1A00-CA43.1	Approved	[33]
Aldosterone	DM9S2JW	Hypertension	BA00-BA04	Approved	[34]
Alectinib	DMP1I6Y	Lung cancer	2C25.0	Approved	[35]
Alfentanil	DMVO0UB	Anaesthesia	9A78.6	Approved	[36]
Aliskiren	DM1BV7W	Hypertension	BA00-BA04	Approved	[37]
Alitretinoin	DMME8LH	Kaposi sarcoma	2B57	Approved	[38]
Almotriptan malate	DMFG5ST	Migraine	8A80	Approved	[39]
Alogliptin	DM8WI3R	Type-2 diabetes	5A11	Approved	[40]
Alosetron	DML2A03	Irritable bowel syndrome	DD91.0	Approved	[41]
Alpelisib	DMEXMYK	Breast cancer	2C60-2C65	Approved	[42]
Alprazolam	DMC7XDN	Anxiety disorder	6B00-6B0Z	Approved	[43]
Ambrisentan	DMD1QXW	Pulmonary arterial hypertension	BB01.0	Approved	[44]
Ambroxol	DMWJE9D	Bronchitis	CA20	Approved	[45]
Amcinonide	DMM1JL9	Inflammation	1A00-CA43.1	Approved	[46]
Amiodarone	DMUTEX3	Tachyarrhythmias	BC71	Approved	[47]
Amitriptyline	DMK7F9S	Depression	6A70-6A7Z	Approved	[48]
Amlodipine	DMBDAZV	Hypertension	BA00-BA04	Approved	[49]
Amprenavir	DMLMXE0	Human immunodeficiency virus infection	1C62	Approved	[50]
Anastrozole	DMNP60F	Breast cancer	2C60-2C65	Approved	[51]
Apixaban	DM89JLN	Thrombosis	DB61-GB90	Approved	[52]
Apremilast	DMTWS9E	Psoriasis vulgaris	EA90	Approved	[53]
Aprepitant	DM053KT	Depression	6A70-6A7Z	Approved	[54]
Argatroban	DMFI46A	Thrombosis	DB61-GB90	Approved	[55]
Aripiprazole	DM3NUMH	Erythropoietic porphyrias	5C58.12	Approved	[56]
Armodafinil	DMGB035	Pediatric cancer	2A00-2F9Z	Approved	[57]
Arn-509	DMT81LZ	Acute myeloid leukaemia	2A60	Approved	[58]
Artemether	DM48QOT	Malaria	1F40-1F45	Approved	[59]
Artemisinin	DMOY7W3	Malaria	1F40-1F45	Approved	[60]
Asenapine	DMSQZE2	Schizophrenia	6A20	Approved	[61]
Atazanavir	DMSYRBX	Human immunodeficiency virus infection	1C62	Approved	[62]
Atenolol	DMNKG1Z	Hypertension	BA00-BA04	Approved	[63]
Atorvastatin	DMF28YC	Cardiovascular disease	BA00-BE2Z	Approved	[64]
Atovaquone	DMY4UMW	Fungal infection	1F29-1F2F	Approved	[65]
Avanafil	DM75CXN	Erectile dysfunction	HA01.1	Approved	[66]
Axitinib	DMGVH6N	Renal cell carcinoma	2C90	Approved	[67]
Azelastine	DMXTMBJ	Allergic conjunctivitis	9A60.02	Approved	[68]
Aztreonam	DMDNJHG	Bacterial infection	1A00-1C4Z	Approved	[69]
Baloxavir marboxil	DM1UV7F	Influenza virus infection	1E30-1E32	Approved	[70]
Baricitinib	DM4ONW5	Rheumatoid arthritis	FA20	Approved	[71]
Bay 80-6946	DMLOS5R	Follicular lymphoma	2A80	Approved	[72]
Beclomethasone	DMZPHIK	Allergic rhinitis	CA08.0	Approved	[73]
Bedaquiline	DM3906J	Multi-drug resistant tuberculosis	MG52.00	Approved	[74]
Benzphetamine	DMIJATC	Obesity	5B81	Approved	[75]
Bepridil	DM0RKS4	Chronic/stable angina	BA40.1	Approved	[76]
Betamethasone valerate	DMMIAXO	Dermatological disease	DA24.Y	Approved	[77]
Bexarotene	DMOBIKY	Cutaneous T-cell lymphoma	2B01	Approved	[45]
Bezafibrate	DMZDCS0	Hyperlipidaemia	5C80	Approved	[78]
Bicalutamide	DMZMSPF	Prostate cancer	2C82.0	Approved	[79]
Bimatoprost	DMX0E5B	Alopecia	ED70	Approved	[80]
Bisoprolol	DM3UZ95	Hypertension	BA00-BA04	Approved	[81]
Boceprevir	DMBSHMF	Hepatitis C virus infection	1E51.1	Approved	[82]
Bortezomib	DMNO38U	Mantle cell lymphoma	2A85.5	Approved	[83]
Bosentan	DMIOGBU	Pulmonary arterial hypertension	BB01.0	Approved	[84]
Bosutinib	DMTI8YE	Breast cancer	2C60-2C65	Approved	[85]
Brentuximab vedotin	DMWLC57	Hodgkin lymphoma	2B30	Approved	[86]
Brilinta	DMBR01X	Thrombosis	DB61-GB90	Approved	[87]
Brinzolamide	DMBAPFG	Open-angle glaucoma	9C61	Approved	[45]
Bromocriptine	DMVE3TK	Parkinson disease	8A00.0	Approved	[88]
Bromperidol	DM24XYQ	Schizophrenia	6A20	Approved	[89]
Budesonide	DMJIBAW	Asthma	CA23	Approved	[90]
Bupivacaine	DM4PRFC	Anaesthesia	9A78.6	Approved	[91]
Buprenorphine	DMPRI8G	Pain	MG30-MG3Z	Approved	[92]
Buspirone	DMBS632	Anxiety disorder	6B00-6B0Z	Approved	[93]
Busulfan	DMXYJ9C	Myeloproliferative syndrome	2A22	Approved	[94]
Cabazitaxel	DMPAZHC	Breast cancer	2C60-2C65	Approved	[95]
Cabergoline	DMQ4HIN	Hyperprolactinaemia	5A60.1	Approved	[96]
Cabozantinib	DMIYDT4	Thyroid cancer	2D10	Approved	[97]
Caffeine	DMKBJWP	Orthostatic hypotension	BA21	Approved	[98]
Calcitriol	DM8ZVJ7	Congenital alopecia	LC30	Approved	[99]
Canagliflozin	DMFRM1I	Type-2 diabetes	5A11	Approved	[100]
Cannabidiol	DM0659E	Dravet syndrome	8A61.11	Approved	[101]
Capsaicin	DMGMF6V	Neuropathic pain	8E43.0	Approved	[102]
Carbamazepine	DMZOLBI	Epilepsy	8A60-8A68	Approved	[103]
Cariprazine	DMJYDVK	Bipolar disorder	6A60	Approved	[104]
Carvedilol	DMHTEAO	Congestive heart failure	BD10	Approved	[105]
Celecoxib	DM6LOQU	Rheumatoid arthritis	FA20	Approved	[106]
Cenobamate	DM8KLU9	Complex partial seizure	8A68.0	Approved	[107]
Cephalexin	DMD5JU8	Bacterial infection	1A00-1C4Z	Approved	[108]
Cerivastatin	DMXCM7H	Hyperlipidaemia	5C80	Approved	[64]
Cevimeline	DMWSMND	Sjogren syndrome	4A43.20	Approved	[109]
Chenodiol	DMQ8JIK	Cholelithiasis	DC11	Approved	[110]
Chloroquine	DMSI5CB	Malaria	1F40-1F45	Approved	[111]
Chlorpheniramine	DM5URA2	Allergic rhinitis	CA08.0	Approved	[112]
Chlorpromazine	DMBGZI3	Schizophrenia	6A20	Approved	[113]
Chlorzoxazone	DMCYVDT	Acute pain	MG31	Approved	[45]
Ciclesonide	DM2NA4K	Asthma	CA23	Approved	[114]
Ciclosporin	DMAZJFX	Hepatitis virus infection	1E50-1E51	Approved	[115]
Cilostazol	DMZMSCT	Intermittent claudication	BD40.00	Approved	[116]
Cinacalcet	DMCX0K3	Hyperparathyroidism	5A51	Approved	[117]
Cinnarizine	DM7U5QJ	Vertigo meniere disease	AB31.0	Approved	[76]
Ciprofibrate	DMGC5DB	Hyperlipoproteinemia	5C80	Approved	[78]
Cisapride	DMY7PED	Gastroesophageal reflux disease	DA22.Z	Approved	[118]
Citalopram	DM2G9AE	Depression	6A70-6A7Z	Approved	[119]
Clarithromycin	DM4M1SG	Bacterial infection	1A00-1C4Z	Approved	[120]
Clevidipine butyrate	DMW4M97	Hypertension	BA00-BA04	Approved	[76]
Clindamycin	DM15HL8	Acne vulgaris	ED80	Approved	[121]
Clobazam - Lundbeck	DMW1OQ0	Anxiety disorder	6B00-6B0Z	Approved	[122]
Clofazimine	DMEBOFW	Crohn disease	DD70	Approved	[45]
Clofibrate	DMPC1J7	Dysbetalipoproteinemia	5C80.2	Approved	[78]
Clonazepam	DMTO13J	Epilepsy	8A60-8A68	Approved	[75]
Clonidine	DM6RZ9Q	Hypertension	BA00-BA04	Approved	[123]
Clopidogrel	DMOL54H	Thrombosis	DB61-GB90	Approved	[64]
Clorazepate	DMC3JST	Anxiety disorder	6B00-6B0Z	Approved	[124]
Clotiazepam	DM59AZT	Anxiety disorder	6B00-6B0Z	Approved	[125]
Clotrimazole	DMMFCIH	Fungal infection	1F29-1F2F	Approved	[126]
Clozapine	DMFC71L	Schizophrenia	6A20	Approved	[127]
Cobicistat	DM6L4H2	Human immunodeficiency virus infection	1C62	Approved	[128]
Cocaine	DMSOX7I	Anaesthesia	9A78.6	Approved	[45]
Codeine	DMJX6ZG	Pain	MG30-MG3Z	Approved	[129]
Colchicine	DM2POTE	Acute gouty arthritis	FA25.0	Approved	[130]
Conivaptan	DM1V329	Euvolemic hyponatremia	5C72	Approved	[131]
Conjugated estrogens	DMLT0E1	Menopause symptom	GA30.0	Approved	[132]
Connexyn	DMF29Q5	Attention deficit hyperactivity disorder	6A05.Z	Approved	[133]
Corticotropin	DMP9TWZ	Cushing disease	5A70	Approved	[134]
Cortisone acetate	DMG8K57	Solid tumour/cancer	2A00-2F9Z	Approved	[135]
Crizotinib	DM4F29C	Non-small-cell lung cancer	2C25.Y	Approved	[136]
Cyclandelate	DMO0R76	Dementia	6D80-6D86	Approved	[76]
Cyclobenzaprine	DM1YBRM	Depression	6A70-6A7Z	Approved	[137]
Cyclophosphamide	DM4O2Z7	Solid tumour/cancer	2A00-2F9Z	Approved	[138]
Cytarabine	DMZD5QR	Acute lymphoblastic leukaemia	2A85	Approved	[139]
Dabrafenib	DMX6OE3	Melanoma	2C30	Approved	[140]
Daclatasvir	DMSFK9V	Hepatitis C virus infection	1E51.1	Approved	[141]
Dacomitinib	DMOH8VY	Non-small-cell lung cancer	2C25.Y	Approved	[142]
Dantrolene	DM1D8XY	Hyperthermia	MG26	Approved	[45]
Dapagliflozin	DM28UJG	Type-2 diabetes	5A11	Approved	[143]
Dapsone	DM4LT8A	Pneumocystis pneumonia	CA40.20	Approved	[144]
Darifenacin	DMWXLYZ	Overactive bladder	GC50.0	Approved	[145]
Darolutamide	DMV7YFT	Prostate cancer	2C82.0	Approved	[146]
Darunavir	DMN3GCH	Human immunodeficiency virus infection	1C62	Approved	[147]
Dasatinib	DMJV2EK	Chronic myelogenous leukaemia	2A20.0	Approved	[148]
Daunorubicin	DMQUSBT	Acute myeloid leukaemia	2A60	Approved	[149]
Deflazacort	DMV0RNS	Duchenne dystrophy	8C70	Approved	[150]
Delamanid	DMXE76K	Multi-drug resistant tuberculosis	MG52.00	Approved	[151]
Delavirdine	DM3NF5G	Human immunodeficiency virus infection	1C62	Approved	[152]
Desipramine	DMT2FDC	Attention deficit hyperactivity disorder	6A05.Z	Approved	[153]
Desogestrel	DM27U4Y	Contraception	QA21	Approved	[154]
Desonide	DMTP2NJ	Atopic dermatitis	EA80	Approved	[45]
Desoxycorticosterone acetate	DMS0AFE	Discovery agent	N.A.	Approved	[155]
Desoxycorticosterone pivalate	DMSA4B3	Addison disease	5A74.0	Approved	[155]
Desvenalfaxine succinate	DMJE6KO	Fibromyalgia	MG30.01	Approved	[156]
Dexamethasone	DMMWZET	Rheumatoid arthritis	FA20	Approved	[157]
Dexamethasone sodium phosphate	DMIG8DW	Ataxia-telangiectasia	4A01.31	Approved	[157]
Dexlansoprazole	DM1DBV5	Erosive esophagitis	DA25.0	Approved	[158]
Dextromethorphan	DMUDJZM	Cough	MD12	Approved	[159]
Dextropropoxyphene	DM23HCX	Pain	MG30-MG3Z	Approved	[160]
Diazepam	DM08E9O	Epilepsy	8A60-8A68	Approved	[161]
Diclofenac	DMPIHLS	Osteoarthritis	FA00-FA05	Approved	[162]
Diethylstilbestrol	DMN3UXQ	Gonorrheal vaginitis	GA02	Approved	[163]
Difluprednate	DMMFVB3	Ocular pain	MC18	Approved	[164]
Digitoxin	DMWVIGP	Arrhythmia	BC9Z	Approved	[165]
Digoxin	DMQCTIH	Arrhythmia	BC9Z	Approved	[166]
Dihydralazine	DMZIXU9	Hypertension	BA00-BA04	Approved	[167]
Dihydroergotamine	DM5IKUF	Migraine	8A80	Approved	[168]
Diltiazem	DMAI7ZV	Hypertension	BA00-BA04	Approved	[169]
Dirithromycin	DM0D9YJ	Bacterial infection	1A00-1C4Z	Approved	[170]
Disopyramide	DM5SYZP	Ventricular arrhythmias	BC71	Approved	[171]
Disulfiram	DMCL2OK	Alcohol dependence	6C40.2	Approved	[172]
Docetaxel	DMDI269	Solid tumour/cancer	2A00-2F9Z	Approved	[173]
Dofetilide	DMPN1TW	Sinus rhythm disorder	BC9Y	Approved	[174]
Dolasetron	DMMG26Z	Nausea	MD90	Approved	[175]
Dolutegravir	DMCZGRE	Human immunodeficiency virus infection	1C62	Approved	[176]
Domperidone	DMBDPY0	Gastrointestinal disease	DE2Z	Approved	[177]
Donepezil	DMIYG7Z	Alzheimer disease	8A20	Approved	[178]
Dorzolamide	DMA17D0	Open-angle glaucoma	9C61	Approved	[45]
Doxapram	DMCYANK	Respiratory disease	CB40	Approved	[179]
Doxazosin	DM9PLRH	Hypertension	BA00-BA04	Approved	[180]
Doxepin	DMPI98T	Depression	6A70-6A7Z	Approved	[181]
Doxorubicin	DMVP5YE	Solid tumour/cancer	2A00-2F9Z	Approved	[182]
Doxycycline	DM7ICNU	Advanced gum disease	DA0D	Approved	[183]
Dronedarone	DMA8FS5	Angina pectoris	BA40	Approved	[184]
Drospirenone	DM1A9W3	Contraception	QA21	Approved	[185]
DU-176B	DMCIJBH	Atrial fibrillation	BC81.3	Approved	[186]
Dydrogesterone	DMAKIDV	Menstrual disorder	GA20.3	Approved	[187]
E-2007	DMJDYNQ	Diabetic neuropathy	8C0Z	Approved	[188]
Efavirenz	DMC0GSJ	Human immunodeficiency virus infection	1C62	Approved	[189]
Elbasvir	DMJLE18	Hepatitis virus infection	1E50-1E51	Approved	[190]
Eletriptan	DMW649X	Migraine	8A80	Approved	[64]
Eliglustat tartrate	DMSRZAO	Metabolic disorder	5C50-5D2Z	Approved	[64]
Elvitegravir	DMG9B1U	Human immunodeficiency virus infection	1C62	Approved	[191]
Emetine	DMCT2YF	Hepatitis virus infection	1E50-1E51	Approved	[192]
Enalapril	DMNFUZR	Hypertension	BA00-BA04	Approved	[45]
Entrectinib	DMMPTLH	Non-small cell lung cancer	2C25	Approved	[193]
Epinastine	DMX0K3Q	Allergic conjunctivitis	9A60.02	Approved	[194]
Eplerenone	DMF0NQR	Heart failure	BD10-BD13	Approved	[195]
Erdafitinib	DMI782S	Bladder cancer	2C94	Approved	[196]
Ergocalciferol	DMHO0AR	Hypoparathyroidism	5A50	Approved	[197]
Ergonovine	DM0VEC1	Postpartum haemorrhage	JA43	Approved	[198]
Ergotamine	DMKR3C5	Headache	8A80-8A84	Approved	[199]
Ergotidine	DM78IME	Respiratory allergy	4A80	Approved	[200]
Eribulin	DM1DX4Q	Breast cancer	2C60-2C65	Approved	[201]
Erlotinib	DMCMBHA	Non-small-cell lung cancer	2C25.Y	Approved	[85]
Erythromycin	DM4K7GQ	Bacterial infection	1A00-1C4Z	Approved	[202]
Escitalopram	DMFK9HG	Major depressive disorder	6A70.3	Approved	[119]
Estazolam	DMZGXUM	Insomnia	7A00-7A0Z	Approved	[203]
Estradiol	DMUNTE3	Breast cancer	2C60-2C65	Approved	[204]
Estradiol acetate	DM07U2A	Hormone replacement therapy	8E01	Approved	[205]
Estradiol cypionate	DM27Z5T	Hormone replacement therapy	8E01	Approved	[205]
Estradiol valerate	DM8MC6O	Hormone replacement therapy	8E01	Approved	[205]
Estramustine	DMWTAOI	Prostate cancer	2C82.0	Approved	[206]
Estrone	DM5T6US	Menopausal and postmenopausal disorder	GA30	Approved	[207]
Estropipate	DMRMDWA	Hypogonadism	5A61.0	Approved	[208]
Eszopiclone	DM8RZ9H	Insomnia	7A00-7A0Z	Approved	[64]
Ethanol	DMDRQZU	Chronic pain	MG30	Approved	[45]
Ethchlorvynol	DM53IP1	Insomnia	7A00-7A0Z	Approved	[209]
Ethinyl estradiol	DMODJ40	Female hypogonadism	GA30.6	Approved	[210]
Ethosuximide	DMDZ9LT	Epilepsy	8A60-8A68	Approved	[211]
Ethynodiol diacetate	DMZM84R	Contraception	QA21	Approved	[212]
Etonogestrel	DMKA8J4	Contraception	QA21	Approved	[154]
Etoposide	DMNH3PG	Solid tumour/cancer	2A00-2F9Z	Approved	[213]
Etoricoxib	DM6A4NW	Rheumatoid arthritis	FA20	Approved	[214]
Etravirine	DMGV8QU	Human immunodeficiency virus-1 infection	1C62	Approved	[215]
Everolimus	DM8X2EH	Renal cell carcinoma	2C90	Approved	[216]
Exemestane	DM9HPW3	Hormonally-responsive breast cancer	2C60-2C65	Approved	[217]
Ezetimibe	DM7A8TW	Hypercholesterolaemia	5C80.0	Approved	[218]
Famciclovir	DMJHLSD	Virus infection	1A24-1D9Z	Approved	[219]
Fedratinib hydrochloride	DML2DCR	Myelofibrosis	2A20.2	Approved	[220]
Felbamate	DM1V5ZS	Epilepsy	8A60-8A68	Approved	[221]
Felodipine	DMOSW35	Hypertension	BA00-BA04	Approved	[222]
Fenofibrate	DMFKXDY	High cholesterol level	5C80.0	Approved	[78]
Fentanyl	DM8WAHT	Analgesia	MB40.8	Approved	[223]
Fesoterodine fumarate	DM13495	Overactive bladder	GC50.0	Approved	[224]
Finasteride	DMWV3TZ	Benign prostatic hyperplasia	GA90	Approved	[45]
Flibanserin	DM70DTN	Mood disorder	6A60-6E23	Approved	[225]
Flucloxacillin	DMNUWST	Bacterial infection	1A00-1C4Z	Approved	[226]
Fludrocortisone	DMUDIR8	Cerebral salt-wasting syndrome	5C72	Approved	[45]
Flumethasone	DMUNG4A	Atopic dermatitis	EA80	Approved	[33]
Flunisolide	DMZSWQC	Allergic rhinitis	CA08.0	Approved	[227]
Flunitrazepam	DMGR5Z3	Insomnia	7A00-7A0Z	Approved	[228]
Fluocinolone acetonide	DMG2KI4	Inflammation	1A00-CA43.1	Approved	[227]
Fluocinonide	DM65KL8	Inflammation	1A00-CA43.1	Approved	[227]
Fluorometholone	DM2HKC4	Chronic obstructive pulmonary disease	CA22	Approved	[46]
Fluoxetine	DM3PD2C	Depression	6A70-6A7Z	Approved	[229]
Fluoxymesterone	DMUHCF1	Breast cancer	2C60-2C65	Approved	[230]
Fluprednisolone	DMZWBKG	Asthma	CA23	Approved	[231]
Flurandrenolide	DMHCI9S	Inflammation	1A00-CA43.1	Approved	[33]
Flurazepam	DMAL4G0	Insomnia	7A00-7A0Z	Approved	[232]
Fluspirilene	DMFO843	Schizophrenia	6A20	Approved	[76]
Flutamide	DMK0O7U	Prostate cancer	2C82.0	Approved	[233]
Fluticasone	DMGCSVF	Allergic rhinitis	CA08.0	Approved	[46]
Fluvastatin	DM4MDJY	Hypercholesterolaemia	5C80.0	Approved	[234]
Fosamprenavir	DM4W9B3	Human immunodeficiency virus infection	1C62	Approved	[235]
Fosphenytoin	DMOX3LB	Epilepsy	8A60-8A68	Approved	[236]
Fostamatinib	DM6AUHV	Immune thrombocytopenic purpura	3B64.13	Approved	[237]
Fulvestrant	DM0YZC6	Breast cancer	2C60-2C65	Approved	[238]
Galantamine	DMEO794	Alzheimer disease	8A20	Approved	[239]
Gefitinib	DM15F0X	Solid tumour/cancer	2A00-2F9Z	Approved	[240]
Gemfibrozil	DMD8Q3J	Hyperlipidaemia	5C80	Approved	[78]
Gemtuzumab ozogamicin	DMJ2O7B	Acute myeloid leukaemia	2A60	Approved	[78]
Gestrinone	DMP0OVQ	Breast cancer	2C60-2C65	Approved	[241]
Gilteritinib	DMWQ4MZ	Acute myeloid leukaemia	2A60	Approved	[242]
Glecaprevir	DM31YVO	Hepatitis virus infection	1E50-1E51	Approved	[243]
Glibenclamide	DM8JXPZ	Diabetic complication	5A2Y	Approved	[64]
Glipizide	DMZA5PQ	Diabetic complication	5A2Y	Approved	[244]
Granisetron	DMIUW25	Nausea and vomiting	MD90	Approved	[245]
Grepafloxacin	DMGLX0T	Chronic bronchitis	CA20.1	Approved	[246]
Halaven	DM7JNTV	Breast cancer	2C60-2C65	Approved	[247]
Halcinonide	DMGLAX1	Skin disease	EA00-EM0Z	Approved	[248]
Halofantrine	DMOMK1V	Malaria	1F40-1F45	Approved	[249]
Haloperidol	DM96SE0	Schizophrenia	6A20	Approved	[250]
Halothane	DM80OZ5	Anaesthesia	9A78.6	Approved	[251]
Hexobarbital	DMQ314B	Anaesthesia	9A78.6	Approved	[252]
Hydrocodone bitartrate	DMIAPBE	Neuropathic pain	8E43.0	Approved	[253]
Hydrocortisone	DMGEMB7	Inflammation	1A00-CA43.1	Approved	[254]
Hydromorphone	DMHP21E	Pain	MG30-MG3Z	Approved	[255]
Hydroquinone	DM6AVR4	Melasma	ED60.1	Approved	[256]
Hydroxyamphetamine	DMJAS3O	Horner syndrome	8D8A.1	Approved	[257]
Hydroxychloroquine	DMSIVND	Malaria	1F40-1F45	Approved	[258]
Hydroxyprogesterone	DMIKQH5	Solid tumour/cancer	2A00-2F9Z	Approved	[259]
Hydroxyzine	DMF8Y74	Anxiety disorder	6B00-6B0Z	Approved	[260]
Ibrutinib	DMHZCPO	Mantle cell lymphoma	2A85.5	Approved	[261]
Ibuprofen	DM8VCBE	Pain	MG30-MG3Z	Approved	[262]
Idelalisib	DM602WT	Chronic lymphocytic leukaemia	2A82.0	Approved	[263]
Ifosfamide	DMCT3I8	Solid tumour/cancer	2A00-2F9Z	Approved	[64]
Iloperidone	DM6AUFY	Schizophrenia	6A20	Approved	[264]
Imatinib	DM7RJXL	Acute lymphoblastic leukaemia	2A85	Approved	[265]
Imipramine	DM2NUH3	Depression	6A70-6A7Z	Approved	[153]
Imiquimod	DM1TMA3	Skin cancer	2C30-2C37	Approved	[45]
Indacaterol	DMQJHR7	Chronic obstructive pulmonary disease	CA22	Approved	[266]
Indapamide	DMGN1PW	Hypertension	BA00-BA04	Approved	[267]
Indinavir	DM0T3YH	Human immunodeficiency virus infection	1C62	Approved	[64]
Ipriflavone	DM0IO13	Osteoporosis	FB83.0	Approved	[268]
Irbesartan	DMTP1DC	Hypertension	BA00-BA04	Approved	[269]
Irinotecan	DMP6SC2	Colorectal cancer	2B91.Z	Approved	[270]
Isavuconazonium	DMD45S9	Appendicitis	DB10	Approved	[271]
Isosorbide dinitrate	DMBI4JG	Anal fissure	DB50.0	Approved	[272]
Isosorbide mononitrate	DMYLMU0	Hydrocephalus	8D64	Approved	[272]
Isotretinoin	DM4QTBN	Acne vulgaris	ED80	Approved	[273]
Istradefylline	DM20VSK	Parkinson disease	8A00.0	Approved	[274]
Itraconazole	DMCR1MV	Fungal infection	1F29-1F2F	Approved	[275]
Ivabradine	DM0L594	Angina pectoris	BA40	Approved	[276]
Ivacaftor	DMZC1HS	Cystic fibrosis	CA25	Approved	[277]
Ivermectin	DMDBX5F	Intestinal strongyloidiasis due to nematode parasite	1F6B	Approved	[278]
Ixabepilone	DM2OZ3G	Breast cancer	2C60-2C65	Approved	[279]
Ketamine	DMT5HA4	Anaesthesia	9A78.6	Approved	[280]
Ketobemidone	DMM3L6Z	Pain	MG30-MG3Z	Approved	[281]
Ketoconazole	DMPZI3Q	Fungal infection	1F29-1F2F	Approved	[47]
Lansoprazole	DMXYLQ3	Duodenal ulcer	DA63	Approved	[282]
Lapatinib	DM3BH1Y	Breast cancer	2C60-2C65	Approved	[283]
Lefamulin	DME6G97	Community-acquired pneumonia	CA40.Z	Approved	[284]
Leflunomide	DMR8ONJ	Arthritis	FA20	Approved	[285]
Lercanidipine	DMPWSEM	Hypertension	BA00-BA04	Approved	[286]
Letrozole	DMH07Y3	Hormonally-responsive breast cancer	2C60-2C65	Approved	[287]
Levobupivacaine	DM783CH	Anaesthesia	9A78.6	Approved	[288]
Levocetirizine dihydrochloride	DMW6ZJI	Allergic rhinitis	CA08.0	Approved	[289]
Levomethadyl acetate hydrochloride	DM429AE	Opioid dependence	6C43.2Z	Approved	[290]
Levomilnacipran	DMV26S8	Fibromyalgia	MG30.01	Approved	[]
Levothyroxine	DMHN027	Hypothyroidism	5A00	Approved	[291]
LGX818	DMNQXV8	Melanoma	2C30	Approved	[292]
Lidocaine	DML4ZOT	Anaesthesia	9A78.6	Approved	[293]
Lidoflazine	DMV23GL	Angina pectoris	BA40	Approved	[76]
Liotrix	DMSTXWR	Hypothyroidism	5A00	Approved	[294]
Lisuride	DMCME17	Parkinson disease	8A00.0	Approved	[295]
Lobeglitazone	DMHY3IP	Type-2 diabetes	5A11	Approved	[296]
Lomerizine	DME0TC8	Migraine	8A80	Approved	[76]
Lomitapide mesylate	DMLB4PE	Hypercholesterolaemia	5C80.0	Approved	[297]
Lonafarnib	DMGM2Z6	Hutchinson-Gilford progeria syndrome	LD2B	Approved	[298]
Loperamide	DMOJZQ9	Diarrhea	ME05.1	Approved	[299]
Lopinavir	DMITQS0	Human immunodeficiency virus infection	1C62	Approved	[300]
Loratadine	DMF3AN7	Allergy	4A80-4A85	Approved	[45]
Lorcaserin	DMG6OYJ	Obesity	5B81	Approved	[301]
Lorlatinib	DMICDLV	Non-small-cell lung cancer	2C25.Y	Approved	[302]
Losartan	DM72JXH	Hypertension	BA00-BA04	Approved	[45]
Loteprednol etabonate	DM8QTJI	Eye inflammation	9A02	Approved	[303]
Lovastatin	DM9OZWQ	Hypercholesterolaemia	5C80.0	Approved	[304]
Loxapine	DM8AI9U	Schizophrenia	6A20	Approved	[305]
Lumefantrine	DM29GAD	Malaria	1F40-1F45	Approved	[306]
Lurasidone hydrochloride	DMCVPXO	Schizophrenia	6A20	Approved	[307]
LY2835219	DM93VBZ	Breast cancer	2C60-2C65	Approved	[308]
Macitentan	DMP79A1	Cardiovascular disease	BA00-BE2Z	Approved	[309]
Marinol	DM70IK5	Anorexia nervosa cachexia	6B80	Approved	[64]
Mebendazole	DMO14SG	Worm infection	1F90.Z	Approved	[310]
Medroxyprogesterone	DMBGWPH	Solid tumour/cancer	2A00-2F9Z	Approved	[311]
Medrysone	DMJ90O5	Eye inflammation	9A02	Approved	[46]
Mefloquine	DMWT905	Malaria	1F40-1F45	Approved	[312]
Megestrol	DMDH9KX	Breast cancer	2C60-2C65	Approved	[313]
Meloxicam	DM2AR7L	Arthritis	FA20	Approved	[314]
Meperidine	DMX4GND	Pain	MG30-MG3Z	Approved	[315]
Mephenytoin	DM5UGDK	Epilepsy	8A60-8A68	Approved	[316]
Meprednisone	DMTL9IP	Chronic obstructive pulmonary disease	CA22	Approved	[46]
Mestranol	DMG3F94	Contraception	QA21	Approved	[317]
Methadone	DMTW6IU	Dry cough	MD12	Approved	[318]
Methoxsalen	DME8FZ9	Cutaneous T-cell lymphoma	2B01	Approved	[319]
Methoxyflurane	DML0RAE	Anaesthesia	9A78.6	Approved	[320]
Methylergonovine	DMBEX4O	Spontaneous abortion	JA00.0	Approved	[199]
Methylprednisolone	DM4BDON	Solid tumour/cancer	2A00-2F9Z	Approved	[321]
Methyltestosterone	DMWLFGO	Solid tumour/cancer	2A00-2F9Z	Approved	[322]
Metoclopramide	DMFA5MY	Nausea	MD90	Approved	[323]
Metoprolol	DMOJ0V6	Hypertension	BA00-BA04	Approved	[324]
Metronidazole	DMTIVEN	Amoebiasis	1A36	Approved	[325]
Mexiletine	DMCTE9R	Ventricular tachycardia	BC71	Approved	[326]
Mianserin	DMVKA4O	Depression	6A70-6A7Z	Approved	[291]
Miconazole	DMPMYE8	Fungal infection	1F29-1F2F	Approved	[327]
Midazolam	DMXOELT	Irritability	MB24	Approved	[328]
Midostaurin	DMI6E0R	Acute myeloid leukaemia	2A60	Approved	[329]
Mifepristone	DMGZQEF	Cushing disease	5A70	Approved	[330]
Mirabegron	DMS1GYT	Overactive bladder	GC50.0	Approved	[331]
Mirtazapine	DML53ZJ	Depression	6A70-6A7Z	Approved	[332]
MK-1439	DM215WE	Human immunodeficiency virus infection	1C62	Approved	[333]
Modafinil	DMYILBE	Narcolepsy	7A20	Approved	[45]
Mometasone	DM45OJN	Skin allergy	4A82	Approved	[46]
Montelukast	DMD157S	Asthma	CA23	Approved	[64]
Morphine	DMRMS0L	Chronic pain	MG30	Approved	[334]
Mycophenolate mofetil	DMPQAGE	Organ transplant rejection	NE84	Approved	[335]
Naloxegol	DML0B41	Opioid-induced constipation	DB32.1	Approved	[336]
Nateglinide	DMLK2QH	Diabetic complication	5A2Y	Approved	[337]
Nefazodone	DM4ZS8M	Major depressive disorder	6A70.3	Approved	[338]
Nelfinavir mesylate	DMFX6G8	Human immunodeficiency virus infection	1C62	Approved	[64]
Nevirapine	DM6HX9B	Human immunodeficiency virus infection	1C62	Approved	[339]
Nicardipine	DMCDYW7	High blood pressure	BA00	Approved	[340]
Nicotine	DMWX5CO	Nicotine dependence	6C4A.2	Approved	[341]
Nifedipine	DMSVOZT	Angina pectoris	BA40	Approved	[342]
Nilotinib	DM7HXWT	Chronic myelogenous leukaemia	2A20.0	Approved	[343]
Nimodipine	DMQ0RKZ	Cerebral vasospasm	BA85.Z	Approved	[45]
Nisoldipine	DM7ISKJ	Hypertension	BA00-BA04	Approved	[45]
Nitrazepam	DMEGIQ6	Epilepsy	8A60-8A68	Approved	[344]
Nitrendipine	DM21C09	Hypertension	BA00-BA04	Approved	[45]
Norethindrone acetate	DMDGCQP	Menorrhagia	GA20.50	Approved	[345]
Norgestimate	DMYP4XC	Contraception	QA21	Approved	[346]
Nortriptyline	DM4KDYJ	Depression	6A70-6A7Z	Approved	[347]
Oestradiol valerate and dienogest	DMZK0FQ	Contraception	QA21	Approved	[348]
Olaparib	DM8QB1D	Ovarian cancer	2C73	Approved	[349]
Olopatadine	DMKMWQG	Allergic conjunctivitis	9A60.02	Approved	[350]
Omeprazole	DM471KJ	Gastroesophageal reflux disease	DA22.Z	Approved	[64]
Ondansetron	DMOTQ1I	Chemotherapy-induced nausea	MD90	Approved	[351]
OPC-34712	DMHG57U	Major depressive disorder	6A70.3	Approved	[352]
Ornidazole	DM6QHDJ	Amoebiasis	1A36	Approved	[353]
Orphenadrine citrate	DMFIQ20	Myalgia	FB56.2	Approved	[354]
Ospemifene	DMC4GEI	Dyspareunia	GA12	Approved	[355]
Oxatomide	DM1F42Z	Hay fever	CA08.00	Approved	[356]
Oxazepam	DMXNZM4	Anxiety disorder	6B00-6B0Z	Approved	[357]
Oxybutynin hydrochloride	DMF2KLU	Urinary incontinence	MF50.2	Approved	[358]
Oxymorphone	DM65AGJ	Pain	MG30-MG3Z	Approved	[359]
Palbociclib	DMD7L94	Breast cancer	2C60-2C65	Approved	[360]
Paliperidone	DM7NPJS	Schizophrenia	6A20	Approved	[361]
Palonosetron	DMBHMOX	Nausea	MD90	Approved	[362]
Panobinostat	DM58WKG	Multiple myeloma	2A83	Approved	[363]
Pantoprazole	DMSVOCZ	Gastroesophageal reflux disease	DA22.Z	Approved	[364]
Paramethadione	DMR5ZUP	Fetal trimethadione syndrome	LD2F.0Y	Approved	[365]
Paramethasone	DM6PR40	Inflammation	1A00-CA43.1	Approved	[46]
Paroxetine	DM5PVQE	Depression	6A70-6A7Z	Approved	[366]
Pazopanib	DMF57DM	Renal cell carcinoma	2C90	Approved	[367]
Pentamidine	DMHZJCG	Fungal infection	1F29-1F2F	Approved	[32]
Perazine	DM2AOTZ	Psychotic disorder	6A20-6A25	Approved	[368]
Pergolide mesylate	DM5GKOV	Parkinson disease	8A00.0	Approved	[96]
Perhexiline	DMINO7Z	Angina pectoris	BA40	Approved	[369]
Permethrin	DMZ0Q1G	Sarcoptes scabiei infection	1G04	Approved	[370]
Perphenazine	DMA4MRX	Schizophrenia	6A20	Approved	[371]
PF-04449913	DMSB068	Chronic myelomonocytic leukaemia	2A40	Approved	[]
Phenelzine	DMHIDUE	Depression	6A70-6A7Z	Approved	[372]
Phenobarbital	DMXZOCG	Seizure disorder	8A6Z	Approved	[373]
Phenprocoumon	DMDO279	Thrombosis	DB61-GB90	Approved	[374]
Phentermine	DMG60XN	Obesity	5B81	Approved	[375]
Phenytoin	DMNOKBV	Epilepsy	8A60-8A68	Approved	[376]
Pilocarpine	DMV9ADG	Glaucoma/ocular hypertension	9C61	Approved	[377]
Pimecrolimus	DMZLGRB	Atopic dermatitis	EA80	Approved	[378]
Pimozide	DMW83TP	Schizophrenia	6A20	Approved	[379]
Pinacidil	DMRADYL	High blood pressure	BA00	Approved	[380]
Pioglitazone	DMKJ485	Diabetic complication	5A2Y	Approved	[381]
Pipotiazine	DMC68DF	Schizophrenia	6A20	Approved	[382]
Podofilox	DMT2EJP	Condyloma	1A95	Approved	[383]
Polatuzumab vedotin	DMF6Y0L	Diffuse large B-cell lymphoma	2A81	Approved	[384]
Pomalidomide	DMTGBAX	Systemic sclerosis	4A42	Approved	[385]
Ponatinib	DMYGJQO	Acute lymphoblastic leukaemia	2A85	Approved	[386]
Posaconazole	DMUL5EW	Aspergillosis	1F20	Approved	[387]
Pranlukast	DMYHDCA	Asthma	CA23	Approved	[388]
Prasterone	DM67VKL	Chronic obstructive pulmonary disease	CA22	Approved	[389]
Prasugrel	DM7MT6E	Acute coronary syndrome	BA41	Approved	[390]
Pravastatin	DM6A0X7	Hypercholesterolaemia	5C80.0	Approved	[391]
Prazepam	DMEWC7N	Anxiety disorder	6B00-6B0Z	Approved	[392]
Praziquantel	DMOU1PK	Flatworm infection	1F70-1F86	Approved	[393]
Prednicarbate	DMBUNVW	Inflammation	1A00-CA43.1	Approved	[394]
Prednisolone	DMQ8FR2	Solid tumour/cancer	2A00-2F9Z	Approved	[395]
Prednisone	DM2HG4X	Inflammation	1A00-CA43.1	Approved	[321]
Pretomanid	DMDYA31	Tuberculosis	1B10-1B14	Approved	[396]
Primaquine	DMWQ16I	Malaria	1F40-1F45	Approved	[397]
Progesterone	DMUY35B	Premature labour	JB00	Approved	[389]
Proguanil	DMBL79I	Malaria	1F40-1F45	Approved	[398]
Promazine	DMZAL7W	Psychomotor agitation	MB23.M	Approved	[399]
Promegestone	DMK4S8I	Gynecological disease	GA6Z	Approved	[348]
Propafenone	DMPIBJK	Tachyarrhythmias	BC71	Approved	[400]
Propiverine	DMUWBIJ	Urinary incontinence	MF50.2	Approved	[401]
Propofol	DMB4OLE	Anaesthesia	9A78.6	Approved	[402]
Propranolol	DM79NTF	Migraine	8A80	Approved	[252]
Pyrazinamide	DM4IF32	Mycobacterium infection	1B10-1B21	Approved	[403]
Quazepam	DMY4D87	Insomnia	7A00-7A0Z	Approved	[404]
Quetiapine	DM1N62C	Schizophrenia	6A20	Approved	[405]
Quinidine	DMLPICK	Tachyarrhythmias	BC71	Approved	[406]
Quinine	DMSWYF5	Malaria	1F40-1F45	Approved	[407]
Rabeprazole	DMMZXIW	Bacterial infection	1A00-1C4Z	Approved	[408]
Raloxifene	DMDKF3M	Osteoporosis	FB83.0	Approved	[409]
Ramelteon	DM7IW9J	Insomnia	7A00-7A0Z	Approved	[410]
Ranolazine	DM0C9IL	Chronic/stable angina	BA40.1	Approved	[411]
Reboxetine	DM26PRD	Depression	6A70-6A7Z	Approved	[412]
Regorafenib	DMHSY1I	Metastatic colorectal cancer	2B91	Approved	[413]
Repaglinide	DM5SXUV	Diabetic complication	5A2Y	Approved	[337]
Ribociclib succinate	DM9CIUW	Breast cancer	2C60-2C65	Approved	[414]
Rifabutin	DM1YBHK	Mycobacterium infection	1B10-1B21	Approved	[415]
Rifampicin	DM5DSFZ	Osteoporosis	FB83.0	Approved	[416]
Rifapentine	DMCHV4I	Tuberculosis	1B10-1B1Z	Approved	[417]
Rifaximin	DMW1TV2	Bacterial infection	1A00-1C4Z	Approved	[418]
Rilpivirine	DMJ0QOW	Human immunodeficiency virus infection	1C62	Approved	[419]
Rimexolone	DMTAREC	Arthritis	FA20	Approved	[420]
Riociguat	DMXBLMP	Pulmonary arterial hypertension	BB01.0	Approved	[421]
Risdiplam	DMIMF8J	Spinal muscular atrophy	8B61	Approved	[422]
Risperidone	DMN6DXL	Schizophrenia	6A20	Approved	[45]
Ritonavir	DMU764S	Human immunodeficiency virus infection	1C62	Approved	[423]
Rivaroxaban	DMQMBZ1	Deep vein thrombosis	BD71	Approved	[424]
Rofecoxib	DM3P5DA	Osteoarthritis	FA00-FA05	Approved	[64]
Roflumilast	DMPGHY8	Asthma	CA23	Approved	[425]
Rokitamycin	DMCZWOK	Bacterial infection	1A00-1C4Z	Approved	[426]
Rolapitant	DM8XP26	Chemotherapy-induced nausea	MD90	Approved	[427]
Romidepsin	DMT5GNL	Cutaneous T-cell lymphoma	2B01	Approved	[428]
Ropinirole	DMA6S1D	Parkinson disease	8A00.0	Approved	[429]
Ropivacaine	DMSPJG2	Anaesthesia	9A78.6	Approved	[430]
Rosiglitazone	DMY6EAO	Type-2 diabetes	5A11	Approved	[431]
Rosuvastatin	DMMIQ7G	Hypercholesterolaemia	5C80.0	Approved	[432]
Rotigotine	DMP7X6Q	Parkinson disease	8A00.0	Approved	[96]
Rucaparib	DM9PVX8	Ovarian cancer	2C73	Approved	[]
Safinamide mesylate	DM0J2ZT	Parkinson disease	8A00.0	Approved	[433]
Salbutamol	DMN9CWF	Acute asthma	CA23	Approved	[45]
Salmeterol	DMIEU69	Chronic obstructive pulmonary disease	CA22	Approved	[434]
Saquinavir	DMG814N	Human immunodeficiency virus infection	1C62	Approved	[435]
Saxagliptin	DMGXENV	Type-2 diabetes	5A11	Approved	[436]
Selegiline hydrochloride	DM3VR1L	Parkinson disease	8A00.0	Approved	[437]
Sertraline	DM0FB1J	Depression	6A70-6A7Z	Approved	[366]
Sevoflurane	DMC9O43	Anaesthesia	9A78.6	Approved	[320]
Sibutramine	DMFJTDI	Obesity	5B81	Approved	[438]
Sildenafil citrate	DMSWJ5X	Erectile dysfunction	HA01.1	Approved	[64]
Silodosin	DMJSBT6	Benign prostatic hyperplasia	GA90	Approved	[439]
Simeprevir	DMLUA9D	Chronic HCV-1 infection	1E51.1	Approved	[440]
Simvastatin	DM30SGU	Hypercholesterolaemia	5C80.0	Approved	[441]
Siponimod	DMVCMUJ	Multiple sclerosis	8A40	Approved	[442]
Siponimod	DM2R86O	Multiple sclerosis	8A40	Approved	[442]
Sirolimus	DMGW1ID	Multiple myeloma	2A83	Approved	[45]
Sitagliptin	DMGDKXN	Type-2 diabetes	5A11	Approved	[443]
Solifenacin	DMG592Q	Overactive bladder	GC50.0	Approved	[444]
Sonidegib phosphate	DM72409	Basal cell carcinoma	2C32	Approved	[445]
Sorafenib	DMS8IFC	Hepatocellular carcinoma	2C12.02	Approved	[446]
Stiripentol	DMMSDOY	Dravet syndrome	8A61.11	Approved	[447]
Sufentanil	DMU7YEL	Analgesia	MB40.8	Approved	[448]
Sulfadiazine	DMTW3R8	Rheumatic fever	1B40-1B42	Approved	[45]
Sulfamethoxazole	DMB08GE	Bacterial infection	1A00-1C4Z	Approved	[449]
Sulfinpyrazone	DMEV954	Gout	FA25	Approved	[450]
Sunitinib	DMCBJSR	Gastrointestinal cancer	2C11	Approved	[85]
Suvorexant	DM0E6S3	Insomnia	7A00-7A0Z	Approved	[451]
Tacrolimus	DMZ7XNQ	Organ transplant rejection	NE84	Approved	[45]
Tadalafil	DMJZHT1	Erectile dysfunction	HA01.1	Approved	[452]
Tamoxifen	DMLB0EZ	Breast cancer	2C60-2C65	Approved	[453]
Tamsulosin	DM5QF9V	Benign prostatic hyperplasia	GA90	Approved	[454]
Tasimelteon	DMLOQ1V	Insomnia	7A00-7A0Z	Approved	[455]
Tasosartan	DMM13DI	Hypertension	BA00-BA04	Approved	[45]
Telaprevir	DMMRV29	Hepatitis C virus infection	1E51.1	Approved	[456]
Telithromycin	DMZ4P3A	Bacterial infection	1A00-1C4Z	Approved	[457]
Temazepam	DM02A65	Insomnia	7A00-7A0Z	Approved	[458]
Temsirolimus	DMS104F	Renal cell carcinoma	2C90	Approved	[112]
Tenapanor	DMCOZJY	Irritable bowel syndrome	DD91.0	Approved	[459]
Teniposide	DMLW57T	Acute lymphoblastic leukaemia	2A85	Approved	[460]
Tenofovir alafenamide	DMTQF4A	Hepatitis virus infection	1E50-1E51	Approved	[461]
Tenofovir disoproxil fumarate	DMSY4ZG	Discovery agent	N.A.	Approved	[461]
Terbinafine	DMI6HUW	Fungal infection	1F29-1F2F	Approved	[64]
Testosterone cypionate	DMC1TEV	Testosterone deficiency	5A81.1	Approved	[462]
Theophylline	DMRJFN9	Chronic obstructive pulmonary disease	CA22	Approved	[463]
Thiamylal	DMHDF7B	Anaesthesia	9A78.6	Approved	[464]
Thiotepa	DMIZKOP	Breast cancer	2C60-2C65	Approved	[465]
Tiagabine	DMKSQG0	Epilepsy	8A60-8A68	Approved	[466]
Tianeptine	DMYN8MA	Major depressive disorder	6A70.3	Approved	[467]
Tindamax	DM3OWT4	Bacterial infection	1A00-1C4Z	Approved	[468]
Tipranavir	DM8HJX6	Human immunodeficiency virus infection	1C62	Approved	[469]
Tofacitinib	DMBS370	Rheumatoid arthritis	FA20	Approved	[470]
Tolterodine	DMSHPW8	Overactive bladder	GC50.0	Approved	[471]
Tolvaptan	DMIWFRL	Hyponatraemia	5C72	Approved	[472]
Topiramate	DM82Z30	Alcohol dependence	6C40.2	Approved	[473]
Toremifene	DMQYUWG	Breast cancer	2C60-2C65	Approved	[474]
TP-434	DM5A31S	Intra-abdominal infection	1A40	Approved	[475]
Trabectedin	DMG3Y89	Solid tumour/cancer	2A00-2F9Z	Approved	[476]
Tramadol	DMRQD04	Pain	MG30-MG3Z	Approved	[477]
Tranilast	DME5Y64	Ocular allergy	4A81	Approved	[76]
Trazodone	DMK1GBJ	Depression	6A70-6A7Z	Approved	[478]
Tretinoin	DM49DUI	Acne vulgaris	ED80	Approved	[479]
Triamcinolone diacetate	DM7LRKD	Allergy	4A80-4A85	Approved	[480]
Triazolam	DMETYK5	Insomnia	7A00-7A0Z	Approved	[481]
Triclabendazole	DMPWGBR	Helminth infection	1F90.0	Approved	[482]
Trifarotene	DMOL793	Acne vulgaris	ED80	Approved	[483]
Trilostane	DMQZ9GF	Cushing disease	5A70	Approved	[484]
Trimebutine	DMPYQ7B	Irritable bowel syndrome	DD91.0	Approved	[76]
Trimethadione	DM0Q8MZ	Epilepsy	8A60-8A68	Approved	[365]
Trimethoprim	DMM7CHK	Urinary tract infection	GC08	Approved	[45]
Trofosfamide	DMHB2C3	Non-hodgkin lymphoma	2B33.5	Approved	[485]
Troglitazone	DM3VFPD	Diabetic complication	5A2Y	Approved	[486]
Troleandomycin	DMUZNIG	Bacterial infection	1A00-1C4Z	Approved	[487]
Tropisetron	DMNSJ7V	Fibromyalgia	MG30.01	Approved	[175]
Udenafil	DM1IQRP	Erectile dysfunction	HA01.1	Approved	[488]
Ulipristal	DMBNI20	Contraception	QA21	Approved	[489]
Upadacitinib	DM8T2OI	Rheumatoid arthritis	FA20	Approved	[490]
Valdecoxib	DMAY7H4	Osteoarthritis	FA00-FA05	Approved	[491]
Vandetanib	DMRICNP	Solid tumour/cancer	2A00-2F9Z	Approved	[492]
Vardenafil	DMTBGW8	Erectile dysfunction	HA01.1	Approved	[493]
Velpatasvir	DMGF8ZQ	Hepatitis virus infection	1E50-1E51	Approved	[494]
Vemurafenib	DM62UG5	Melanoma	2C30	Approved	[495]
Venlafaxine	DMR6QH0	Depression	6A70-6A7Z	Approved	[64]
Verapamil	DMA7PEW	Hypertension	BA00-BA04	Approved	[64]
Vilanterol	DMF5EK1	Chronic obstructive pulmonary disease	CA22	Approved	[496]
Vilazodone	DM4LECQ	Major depressive disorder	6A70.3	Approved	[497]
Vinblastine	DM5TVS3	Solid tumour/cancer	2A00-2F9Z	Approved	[498]
Vincamine	DMK1ZOR	Cerebrovascular disease	8B2Z	Approved	[499]
Vincristine	DMINOX3	Acute lymphoblastic leukaemia	2A85	Approved	[500]
Vindesine	DMVR628	Acute lymphoblastic leukaemia	2A85	Approved	[501]
Vinorelbine	DMVXFYE	Solid tumour/cancer	2A00-2F9Z	Approved	[499]
Vinpocetine	DMVN2E6	Ischemic stroke	8B11.5Z	Approved	[76]
Vismodegib	DM5IXKQ	Basal cell carcinoma	2C32	Approved	[502]
Vitamin A	DMJ2AH4	Night blindness	9D45	Approved	[503]
Vitamin D	DMWQUC9	Hyperparathyroidism	5A51	Approved	[504]
Vitamin E	DMZC90K	Cardiovascular disease	BA00-BE2Z	Approved	[505]
Vorapaxar	DMA16BR	Myocardial infarction	BA41-BA43	Approved	[506]
Voriconazole	DMAOL2S	Invasive aspergillosis	1F20.0	Approved	[507]
Vortioxetine	DM6F1PU	Major depressive disorder	6A70.3	Approved	[508]
Voxelotor	DMCS6M5	Sickle-cell disorder	3A51	Approved	[220]
Warfarin	DMJYCVW	Atrial fibrillation	BC81.3	Approved	[509]
Xatral	DMLHOA0	Benign prostatic hyperplasia	GA90	Approved	[510]
Yohimbine	DMJCP1Y	Erectile dysfunction	HA01.1	Approved	[511]
Zafirlukast	DMHNQOG	Asthma	CA23	Approved	[512]
Zalcitabine	DMH7MUV	Human immunodeficiency virus infection	1C62	Approved	[513]
Zaleplon	DMGFWSM	Insomnia	7A00-7A0Z	Approved	[514]
Zanubrutinib	DMUR5NG	Mantle cell lymphoma	2A85.5	Approved	[515]
Ziconotide	DMSLJP4	Pain	MG30-MG3Z	Approved	[76]
Zidovudine	DM4KI7O	Human immunodeficiency virus infection	1C62	Approved	[516]
Zileuton	DMVRIC2	Asthma	CA23	Approved	[64]
Ziprasidone	DMM58JY	Schizophrenia	6A20	Approved	[517]
Zithromax	DMN4H2O	Syphilis infection	1A6Z	Approved	[45]
Zolpidem	DMWOSKJ	Insomnia	7A00-7A0Z	Approved	[518]
Zonisamide	DM0DTF7	Epilepsy	8A60-8A68	Approved	[519]
Zopiclone	DMPI6Z0	Insomnia	7A00-7A0Z	Approved	[520]
Zotepine	DMF3VXA	Anxiety disorder	6B00-6B0Z	Approved	[521]
Icotinib hydrochloride	DM5GFIK	Non-small-cell lung cancer	2C25.Y	Registered	[522]
Aminophenazone	DMY2AH1	Anaesthesia	9A78.6	Phase 4	[523]
Azelnidipine	DMA12HL	Essential hypertension	BA00	Phase 4	[524]
Barnidipine	DMJSDBE	Essential hypertension	BA00	Phase 4	[525]
Beclabuvir	DMLKUG7	Hepatitis virus infection	1E50-1E51	Phase 4	[526]
Benidipine	DMWNP6B	Diabetic nephropathy	GB61.Z	Phase 4	[527]
Brotizolam	DMGXD5T	Insomnia	7A00-7A0Z	Phase 4	[528]
Chlorphenamine	DM6C4YJ	Allergy	4A80-4A85	Phase 4	[112]
Cibenzoline	DMBG0N4	Atrial fibrillation	BC81.3	Phase 4	[529]
Cyproterone acetate	DMLMOIJ	Polycystic ovarian syndrome	5A80.1	Phase 4	[348]
Dapoxetine	DMV6KFY	Premature ejaculation	HA03.0Z	Phase 4	[530]
Demegestone	DMV5KTJ	N. A.	N. A.	Phase 4	[531]
Dihydrocodeine	DMB0FWL	Cancer related pain	MG30	Phase 4	[532]
Ebastine	DMQRX24	Irritable bowel syndrome	DD91.0	Phase 4	[533]
Ergonovine maleate	DM9WPIH	Bleeding disorder	GA20-GA21	Phase 4	[198]
Ethinylestradiol propanesulfonate	DM7ITZK	Prostate cancer	2C82.0	Phase 4	[534]
Etizolam	DM8TNX3	Insomnia	7A00-7A0Z	Phase 4	[535]
Etoperidone	DMR7U8F	Depression	6A70-6A7Z	Phase 4	[536]
Gestodene	DM9R1YU	Contraception	QA21	Phase 4	[537]
Grazoprevir	DM9BPLW	Hepatitis virus infection	1E50-1E51	Phase 4	[538]
Ketazolam	DM170OH	Anxiety disorder	6B00-6B0Z	Phase 4	[392]
Lacidipine	DMQP5I3	Essential hypertension	BA00	Phase 4	[539]
Levamlodipine	DM92S6N	Hypertension	BA00-BA04	Phase 4	[49]
Lynestrenol	DM82JP0	N. A.	N. A.	Phase 4	[345]
Medifoxamine	DM0UGYX	Depression	6A70-6A7Z	Phase 4	[45]
Mexazolam	DME1X96	Anxiety disorder	6B00-6B0Z	Phase 4	[441]
Mosapride	DM2VOQ3	N. A.	N. A.	Phase 4	[540]
Nomegestrol	DMRP8XB	N. A.	N. A.	Phase 4	[348]
Otilonium	DMU1JVW	Irritable bowel syndrome	DD91.0	Phase 4	[76]
Parecoxib	DMIV8CT	N. A.	N. A.	Phase 4	[541]
Pinaverium	DM4OIMZ	Irritable bowel syndrome	DD91.0	Phase 4	[76]
Pregnenolone	DM6VFO1	Schizophrenia	6A20	Phase 4	[542]
Prenylamine	DM8PTSY	Angina pectoris	BA40	Phase 4	[76]
Rupatadine	DMBPN7T	N. A.	N. A.	Phase 4	[543]
Tenofovir disoproxil	DM62IPN	Human immunodeficiency virus infection	1C62	Phase 4	[461]
Vonoprazan	DMCOJPS	Gastro-oesophageal reflux	DA22	Phase 4	[544]

124 Clinical Trial Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
5-methoxypsoralen	DME2A8X	Psoriasis vulgaris	EA90	Phase 3	[545]
ABT-263	DMNE56X	Myelofibrosis	2A20.2	Phase 3	[546]
ABT-761	DM3FIC2	Asthma	CA23	Phase 3	[547]
Al3818	DM3WP0N	Alveolar soft part sarcoma	2A60-2C35	Phase 3	[548]
Alisporivir	DM83EBP	Duchenne dystrophy	8C70	Phase 3	[549]
Anacetrapib	DMP2BFG	Arteriosclerosis	BD40	Phase 3	[550]
Arc029	DMYNJHI	Alzheimer disease	8A20	Phase 3	[551]
Asp-2151	DM5N1OB	Herpes simplex virus infection	1F00	Phase 3	[552]
Atrasentan	DMM74PK	Diabetic nephropathy	GB61.Z	Phase 3	[553]
Azimilide	DMUIBV8	Atrial fibrillation	BC81.3	Phase 3	[554]
Balaglitazone	DMXBHR6	Type-1 diabetes	5A10	Phase 3	[431]
Bay 86-9766	DMPW5SB	Solid tumour/cancer	2A00-2F9Z	Phase 3	[555]
Blonanserin	DM36C17	Schizophrenia	6A20	Phase 3	[556]
Carebastine	DMUVMWZ	Ocular allergy	4A81	Phase 3	[533]
CC-25430	DMV7WSN	Tinnitus	MC41	Phase 3	[76]
Cediranib	DMWO5ZR	Peritoneal cavity cancer	2C51.Z	Phase 3	[557]
Chloride	DM1TJXA	Solid tumour/cancer	2A00-2F9Z	Phase 3	[558]
Cilnidipine	DM1975O	High blood pressure	BA00	Phase 3	[559]
Cinitapride	DMEGFYD	Functional dyspepsia	DD90.3	Phase 3	[560]
Clomethiazole	DMSPN58	Stroke	8B20	Phase 3	[45]
Dalcetrapib	DMKNCVM	Acute coronary syndrome	BA41	Phase 3	[561]
Entresto	DMTWLXY	Acute myocardial infarction	BA41	Phase 3	[562]
Enzastaurin	DM5H0R9	Diffuse large B-cell lymphoma	2A81	Phase 3	[563]
Eperisone	DM1SMAI	Muscle spasm	MB47.3	Phase 3	[564]
Esketamine	DMVU687	Depression	6A70-6A7Z	Phase 3	[280]
Evacetrapib	DMCDZ15	Cardiovascular disease	BA00-BE2Z	Phase 3	[565]
Exatecan	DMCA7FN	Solid tumour/cancer	2A00-2F9Z	Phase 3	[566]
Glycyrrhizin	DM8M2N3	Influenza virus infection	1E30-1E32	Phase 3	[567]
GTPL-9088	DMPS7U2	Atopic dermatitis	EA80	Phase 3	[568]
HE3286	DMB9U5E	Type-2 diabetes	5A11	Phase 3	[569]
HKI-272	DM6QOVN	Breast cancer	2C60-2C65	Phase 3	[570]
Iclaprim	DM7YNV9	Bacterial infection	1A00-1C4Z	Phase 3	[571]
Isavuconazole	DMSV12M	Candidemia	1F23.3Y	Phase 3	[572]
Jakafi	DMNORK8	Essential thrombocythemia	3B63.1Z	Phase 3	[573]
Karenitecin	DMCRGY4	Lung cancer	2C25.0	Phase 3	[574]
L-651582	DMWTPCA	Solid tumour/cancer	2A00-2F9Z	Phase 3	[76]
Laquinimod	DM3IWS8	Lupus	4A40	Phase 3	[575]
Linopirdine	DM0ZOGX	Cognitive impairment	6D71	Phase 3	[576]
LU AE58054	DMWGRQD	Schizophrenia	6A20	Phase 3	[577]
Manidipine	DMJPGUA	N. A.	N. A.	Phase 3	[578]
Maribavir	DM3GTAL	Cytomegalovirus infection	1D82	Phase 3	[579]
Momelotinib	DMF98Q0	Myelofibrosis	2A20.2	Phase 3	[580]
Muraglitazar	DMG3NFZ	N. A.	N. A.	Phase 3	[581]
Nabiximols	DMHKJ5I	Cancer related pain	MG30	Phase 3	[582]
Netupitant	DMEKAYI	Chemotherapy-induced nausea	MD90	Phase 3	[583]
Odanacatib	DM1EO3G	Osteoporosis	FB83.0	Phase 3	[584]
Olodaterol/tiotropium bromide	DM1FBZ7	Chronic obstructive pulmonary disease	CA22	Phase 3	[585]
Plitidepsin	DMJ8AUE	Multiple myeloma	2A83	Phase 3	[586]
Pracinostat	DMTD7AB	Acute myeloid leukaemia	2A60	Phase 3	[587]
Rebamipide	DM2GHCR	Peptic ulcer	DA61	Phase 3	[588]
Remacemide	DM3YXP8	Pain	MG30-MG3Z	Phase 3	[589]
Rifalazil	DMYXOHV	Bacterial infection	1A00-1C4Z	Phase 3	[590]
Rivoglitazone	DMBY31K	Ocular inflammation	9C61.24	Phase 3	[431]
Rolofylline	DMSZPR3	Heart failure	BD10-BD13	Phase 3	[591]
Selinexor	DMBD4K3	Liposarcoma	2B59	Phase 3	[592]
Semagacestat	DML83IW	Parkinson disease	8A00.0	Phase 3	[593]
TAK-875	DMIM5AP	Type-2 diabetes	5A11	Phase 3	[594]
Terodiline	DM4MZXE	Urinary incontinence	MF50.2	Phase 3	[76]
Triptolide	DMCMDVR	Autoimmune diabetes	5A10	Phase 3	[595]
Vicriviroc	DMMTW9K	Human immunodeficiency virus infection	1C62	Phase 3	[64]
Fexinidazole	DMOYE70	Trypanosomiasis	1D51-1F53	Phase 2/3	[596]
Sarizotan	DMH7IPW	Rett syndrome	LD90.4	Phase 2/3	[597]
3,5-diiodothyropropionic acid	DML8M5T	Cardiovascular disease	BA00-BE2Z	Phase 2	[598]
9-AMINOCAMPTOTHECIN	DMQXYRG	Acquired immune deficiency syndrome	1C62.3	Phase 2	[599]
ABT-384	DM7XW5Y	Alzheimer disease	8A20	Phase 2	[600]
Azd2014	DMOEARH	Solid tumour/cancer	2A00-2F9Z	Phase 2	[601]
Bc-3781 intravenous	DMY1UGV	Bacterial infection	1A00-1C4Z	Phase 2	[602]
BIIB014	DMH7RJ1	Parkinson disease	8A00.0	Phase 2	[603]
BMS 650032	DMQI43G	Hepatitis C virus infection	1E51.1	Phase 2	[604]
Carfentanil	DM7ADGX	N. A.	N. A.	Phase 2	[605]
Cenicriviroc	DM4V8WF	Human immunodeficiency virus infection	1C62	Phase 2	[606]
CP-122721	DMSWLM5	Major depressive disorder	6A70.3	Phase 2	[607]
Danoprevir	DM20MDU	Hepatitis C virus infection	1E51.1	Phase 2	[608]
Dexloxiglumide	DM52HUD	Pancreatic malfunction	DC30-DC3Z	Phase 2	[609]
Emivirine	DMQH1NV	Human immunodeficiency virus infection	1C62	Phase 2	[610]
Famitinib	DMSFWT7	Solid tumour/cancer	2A00-2F9Z	Phase 2	[611]
Ferroquine	DMICMXE	Malaria	1F40-1F45	Phase 2	[612]
Gallopamil	DMXBR27	Asthma	CA23	Phase 2	[613]
GS-9620	DMG5C8D	Hepatitis B virus infection	1E51.0	Phase 2	[614]
HE3235	DMV50R1	Breast cancer	2C60-2C65	Phase 2	[615]
Impoyz	DMB1N6P	Plaque psoriasis	EA90.0	Phase 2	[616]
JNJ-37822681	DMV41P5	Schizophrenia	6A20	Phase 2	[617]
KNI-272	DMQZ5HF	Human immunodeficiency virus infection	1C62	Phase 2	[618]
Lersivirine	DMSEVBH	Human immunodeficiency virus infection	1C62	Phase 2	[619]
LY2603618	DMCXRZF	Pancreatic cancer	2C10	Phase 2	[620]
LY333531	DMGMC8H	Solid tumour/cancer	2A00-2F9Z	Phase 2	[621]
MB-07811	DM6JTSZ	Hyperlipidaemia	5C80	Phase 2	[622]
MSC1936369B	DMH1DYU	Colorectal cancer	2B91.Z	Phase 2	[623]
NCI-C50000	DMVQKB3	Pruritus	EC90	Phase 2	[76]
Netoglitazone	DM8H7OA	Non-alcoholic fatty liver disease	DB92	Phase 2	[431]
Onapristone	DMT6E5N	Breast cancer	2C60-2C65	Phase 2	[624]
PDX-101	DM6OC53	Solid tumour/cancer	2A00-2F9Z	Phase 2	[625]
PEG-SN38	DMX9ZM4	Breast cancer	2C60-2C65	Phase 2	[626]
Pradefovir	DM1O0DV	Hepatitis virus infection	1E50-1E51	Phase 2	[627]
Pyrazoloacridine	DMSOPAU	Colorectal cancer	2B91.Z	Phase 2	[403]
R-roscovitine	DMSH108	Non-small-cell lung cancer	2C25.Y	Phase 2	[628]
Sutezolid	DM2KQ71	Tuberculosis	1B10-1B1Z	Phase 2	[629]
Terguride	DMZNFPG	Pulmonary arterial hypertension	BB01.0	Phase 2	[630]
Tocopherol	DMBIJZ6	Phenylketonuria	5C50.0	Phase 2	[631]
Trastuzumab Emtansine	DMU1LXS	HER2-positive breast cancer	2C60-2C65	Phase 2	[170]
Vilaprisan	DME7VZD	Endometriosis	GA10	Phase 2	[632]
BRN-3122594	DMQKXSW	Hemorrhoids	DB60	Phase 1/2	[46]
CC-223	DMMQYL9	Solid tumour/cancer	2A00-2F9Z	Phase 1/2	[633]
Dexamethasone palmitate	DMCMT4V	Choroidal neovascularization	9B76	Phase 1/2	[634]
GEA-6414	DM8J0MK	Parkinson disease	8A00.0	Phase 1/2	[76]
H3B-6545	DMIFCY2	Breast cancer	2C60-2C65	Phase 1/2	[635]
LS-172108	DMZNIAG	Ischemic stroke	8B11.5Z	Phase 1/2	[636]
LY2940680	DMTJWIQ	Solid tumour/cancer	2A00-2F9Z	Phase 1/2	[637]
TG02	DMZFIGQ	Anaplastic astrocytoma	2A00.0	Phase 1/2	[638]
ABT-333	DM7TOWX	Hepatitis C virus infection	1E51.1	Phase 1	[639]
Azd-3839	DM72FOD	Alzheimer disease	8A20	Phase 1	[640]
Calanolide A	DMQTUH8	Mycobacterium infection	1B10-1B21	Phase 1	[641]
Capravirine	DM9ERH1	Human immunodeficiency virus infection	1C62	Phase 1	[642]
Clemizole	DM4UAPD	Hepatitis C virus infection	1E51.1	Phase 1	[643]
GS-9883	DMMF5IE	Human immunodeficiency virus infection	1C62	Phase 1	[644]
H3B-6527	DMAYTRK	Hepatocellular carcinoma	2C12.02	Phase 1	[645]
ITX-5061	DM702MU	Human immunodeficiency virus-1 infection	1C62	Phase 1	[646]
LY-2811376	DM8LGWR	Alzheimer disease	8A20	Phase 1	[647]
Mibefradil	DMU9VDS	Glioblastoma multiforme	2A00.0	Phase 1	[648]
MLN8054	DMUANF3	Solid tumour/cancer	2A00-2F9Z	Phase 1	[649]
Safingol	DMBGUDR	Psoriasis vulgaris	EA90	Phase 1	[650]
SC-20713	DM7GSLB	Contraception	QA21	Phase 1	[212]
Teneligliptin	DMGJCDR	Type-2 diabetes	5A11	Phase 1	[651]
Tetrandrine	DMAOJBX	Sarcoma	2A60-2C35	Phase 1	[76]

39 Discontinued Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Astemizole	DM2HN6Q	Allergic rhinitis	CA08.0	Withdrawn from market	[45]
Fendiline	DMH6NG5	Coronary artery disease	BA80	Withdrawn from market	[76]
Methaqualone	DMW9NY0	Insomnia	7A00-7A0Z	Withdrawn from market	[652]
Phenacetin	DMRQAM0	Analgesia	MB40.8	Withdrawn from market	[653]
Roxithromycin	DMVMIK2	Bacterial infection	1A00-1C4Z	Withdrawn from market	[654]
Sertindole	DMMP65N	Schizophrenia	6A20	Withdrawn from market	[655]
Terfenadine	DM4KLPT	Allergy	4A80-4A85	Withdrawn from market	[167]
Zomepirac	DM7APNJ	Pain	MG30-MG3Z	Withdrawn from market	[656]
Epothilone B	DMM5ZX6	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 3	[279]
GW873140	DMG6TS2	Human immunodeficiency virus-1 infection	1C62	Discontinued in Phase 3	[657]
Seletracetam	DM3IJMN	Epilepsy	8A60-8A68	Discontinued in Phase 3	[76]
Seratrodast	DMPNTDL	Allergic asthma	CA23.0	Discontinued in Phase 3	[658]
Octopamine	DMLQVTJ	Thrombosis	DB61-GB90	Discontinued in Phase 2a	[659]
Benzydamine	DMEQL9U	Chemotherapy or radiotherapy-induced mucositis	DA42-DA60	Discontinued in Phase 2	[660]
BMS-181101	DMT4VSE	Mood disorder	6A60-6E23	Discontinued in Phase 2	[661]
BMS-488043	DMRPU10	Human immunodeficiency virus infection	1C62	Discontinued in Phase 2	[662]
Dexniguldipine	DMLZIT2	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 2	[76]
Ezlopitant	DMTUPZ2	Irritable bowel syndrome	DD91.0	Discontinued in Phase 2	[663]
FCP-3P1	DMTQLIJ	Arteriosclerosis	BD40	Discontinued in Phase 2	[49]
GW-766994	DMKC0J5	Asthma	CA23	Discontinued in Phase 2	[664]
Norcisapride	DMJSKUI	Gastroesophageal reflux disease	DA22.Z	Discontinued in Phase 2	[665]
Prednisolone sodium metazoate	DM082ZW	Inflammatory bowel disease	DD72	Discontinued in Phase 2	[666]
RS-8359	DMERM0K	Major depressive disorder	6A70.3	Discontinued in Phase 2	[667]
Tesmilifene	DMPB36I	Breast cancer	2C60-2C65	Discontinued in Phase 2	[668]
Torcetrapib	DMDHYM7	Hyperlipidaemia	5C80	Discontinued in Phase 2	[669]
Banoxantrone	DMK5I07	Acute lymphoblastic leukaemia	2A85	Discontinued in Phase 1	[670]
Mofarotene	DMKHEQL	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 1	[671]
Roquinimex	DMMK42O	Rheumatoid arthritis	FA20	Discontinued in Phase 1	[672]
Vanoxerine	DMBQPA5	Cocaine addiction	6C45.2	Discontinued in Phase 1	[673]
VR-776	DMFQWNI	Premature ejaculation	HA03.0Z	Discontinued in Phase 1	[674]
Darodipine	DM160FM	Cerebrovascular ischaemia	8B1Z	Terminated	[76]
Dotarizine	DM6Q05K	Migraine	8A80	Terminated	[76]
Emopamil	DMW210B	Cerebrovascular ischaemia	8B1Z	Terminated	[76]
Flosequinan	DMY89KQ	Cardiovascular disease	BA00-BE2Z	Terminated	[678]
Gepirone	DMGX5Q0	Depression	6A70-6A7Z	Terminated	[679]
Niguldipine	DMSPWMF	N. A.	N. A.	Terminated	[76]
Nimesulide	DMR1NMD	Metastatic colorectal cancer	2B91	Terminated	[76]
NSC-303812	DMEYMHB	Hypophosphatasia	5C64.3	Discontinued	[680]
WIN-55212-2	DMACBIW	N. A.	N. A.	Terminated	[76]

4 Preclinical Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Oxycodone hydrochloride	DMCA7LN	Chronic pain	MG30	Application submitted	[675]
Ciglitazone	DMAPO0T	Pulmonary fibrosis	CB03.4	Preclinical	[431]
Organon	DMERWUC	Schizophrenia	6A20	Preclinical	[676]
VUFB-11502	DM7WFR0	Intestinal amebiasis	1A36	Preclinical	[677]

31 Investigative Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(11-BETA)-11,21-DIHYDROXY-PREGN-4-ENE-3,20-DIONE	DMTPQ84	Discovery agent	N.A.	Investigative	[681]
6-Benzyloxy-9H-purin-2-ylamine	DMFI7A8	Discovery agent	N.A.	Investigative	[682]
Agmatine	DMSBZ29	Discovery agent	N.A.	Investigative	[76]
Bencyclane	DM7H3VY	Cerebral vasospasm	BA85.Z	Investigative	[76]
Benzodiazepine	DM9H34M	Anxiety disorder	6B00-6B0Z	Investigative	[45]
Benzotetronic acid	DM4OKXI	Discovery agent	N.A.	Investigative	[683]
Benzyloxyresorufin	DM26SR7	Discovery agent	N.A.	Investigative	[684]
Butyrfentanyl	DM9X2FV	Anaesthesia	9A78.6	Investigative	[685]
Chlormadinone	DM64K0A	Discovery agent	N.A.	Investigative	[531]
Clorindione	DMLPXNC	Hypercholesterolaemia	5C80.0	Investigative	[686]
CTK1G9578	DMI3J0F	Discovery agent	N.A.	Investigative	[687]
CV-4093	DM983QP	Discovery agent	N.A.	Investigative	[578]
Cyamemazine	DMZ6YPV	Discovery agent	N.A.	Investigative	[688]
Dexverapamil	DM9P4JW	Discovery agent	N.A.	Investigative	[76]
Dihydrostreptomycin	DMPDQSV	Pulmonary tuberculosis	1B10.Z	Investigative	[134]
Equilenin	DMHO56W	Discovery agent	N.A.	Investigative	[689]
Erythromycin salnacedin	DM0PHEW	Discovery agent	N.A.	Investigative	[202]
Ethyl biscoumacetate	DMR5Z2A	Thrombosis	DB61-GB90	Investigative	[690]
Ethylmorphine	DM0YROF	Discovery agent	N.A.	Investigative	[691]
Imipramine oxide	DMZKABS	Depression	6A70-6A7Z	Investigative	[692]
Medazepam	DMNKSX3	Discovery agent	N.A.	Investigative	[693]
Medrogestone	DMNEAJG	N. A.	N. A.	Investigative	[694]
Mepacrine	DMU8L7C	Discovery agent	N.A.	Investigative	[695]
Miocamycin	DMDQK9G	Pulmonary tuberculosis	1B10.Z	Investigative	[696]
Niludipine	DM8OGMA	Cerebral vasospasm	BA85.Z	Investigative	[76]
Nordazepam	DMHAWYQ	Anxiety disorder	6B00-6B0Z	Investigative	[697]
Paraoxon	DMN4ZKC	Discovery agent	N.A.	Investigative	[698]
Phenazone	DMCE985	Discovery agent	N.A.	Investigative	[64]
Talinolol	DMRTD16	Discovery agent	N.A.	Investigative	[699]
Taurochenodeoxycholic acid	DMEL9UT	Discovery agent	N.A.	Investigative	[700]
[3H]estrone-3-sulphate	DMGPF0N	Discovery agent	N.A.	Investigative	[208]

Molecular Expression Atlas (MEA) of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	7.29E-03	-3.47E-02	-1.80E-01
Alopecia	ED70	Skin from scalp	4.73E-01	-3.42E-03	-9.10E-03
Alzheimer's disease	8A20	Entorhinal cortex	1.04E-02	6.29E-02	3.54E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	6.78E-01	-5.92E-02	-3.47E-01
Aortic stenosis	BB70	Calcified aortic valve	8.46E-01	-1.10E-01	-1.82E-01
Apnea	7A40	Hyperplastic tonsil	8.97E-01	2.63E-01	1.40E+00
Arthropathy	FA00-FA5Z	Peripheral blood	3.22E-01	6.75E-02	4.19E-01
Asthma	CA23	Nasal and bronchial airway	6.90E-01	2.35E-02	7.88E-02
Atopic dermatitis	EA80	Skin	2.52E-04	9.69E-02	7.57E-01
Autism	6A02	Whole blood	6.09E-01	-5.31E-02	-2.65E-01
Autoimmune uveitis	9A96	Peripheral monocyte	2.47E-01	-1.84E-01	-9.58E-01
Autosomal dominant monocytopenia	4B04	Whole blood	4.87E-01	-6.16E-02	-5.64E-01
Bacterial infection of gingival	1C1H	Gingival tissue	2.79E-02	-8.65E-02	-3.88E-01
Batten disease	5C56.1	Whole blood	1.89E-01	1.66E-01	9.51E-01
Behcet's disease	4A62	Peripheral blood	1.52E-01	4.31E-02	3.07E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	8.31E-01	-4.19E-02	-2.14E-01
Bladder cancer	2C94	Bladder tissue	2.23E-11	4.66E-01	5.83E+00
Breast cancer	2C60-2C6Z	Breast tissue	1.87E-03	-6.67E-02	-2.12E-01
Cardioembolic stroke	8B11.20	Whole blood	1.87E-01	-1.13E-01	-5.03E-01
Cervical cancer	2C77	Cervical tissue	2.13E-04	-2.15E-01	-9.34E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	9.83E-01	-1.32E-02	-4.74E-02
Chronic hepatitis C	1E51.1	Whole blood	6.61E-01	9.46E-03	3.66E-02
Chronic obstructive pulmonary disease	CA22	Lung tissue	2.13E-01	4.03E-02	2.50E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	8.21E-02	8.17E-02	4.35E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	6.50E-01	1.42E-01	1.16E+00
Colon cancer	2B90	Colon tissue	1.19E-03	-7.56E-02	-1.51E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	5.06E-01	-1.48E-01	-8.48E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	8.00E-01	4.53E-02	1.94E-01
Endometriosis	GA10	Endometrium tissue	9.50E-01	8.27E-02	3.14E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	5.08E-01	-8.08E-02	-5.30E-01
Familial hypercholesterolemia	5C80.00	Whole blood	3.24E-05	-3.48E-01	-1.34E+00
Gastric cancer	2B72	Gastric tissue	4.97E-02	1.84E-01	1.84E+00
Glioblastopma	2A00.00	Nervous tissue	8.54E-05	-6.60E-02	-1.90E-01
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	5.50E-01	-9.32E-02	-1.01E+00
Glioma	2A00.0Y-2A00.0Z	White matter tissue	2.15E-08	-6.60E-01	-3.96E+00
Head and neck cancer	2D42	Head and neck tissue	5.04E-04	-9.90E-02	-3.91E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	3.40E-02	-1.70E-01	-7.22E-01
Huntington's disease	8A01.10	Whole blood	4.43E-01	-2.48E-02	-1.78E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	1.36E-01	-2.34E-01	-1.17E+00
Immunodeficiency	4A00-4A20	Peripheral blood	3.15E-01	-1.31E-02	-9.45E-02
Influenza	1E30	Whole blood	3.14E-01	1.43E-01	6.67E+00
Interstitial cystitis	GC00.3	Bladder tissue	4.87E-01	-4.14E-02	-5.17E-01
Intracranial aneurysm	8B01.0	Intracranial artery	7.63E-01	6.68E-02	3.45E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	9.40E-01	-2.17E-02	-4.03E-02
Ischemic stroke	8B11	Peripheral blood	4.29E-02	1.11E-01	6.58E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	3.39E-03	1.17E-01	4.33E-01
Lateral sclerosis	8B60.4	Skin	3.18E-03	2.30E-01	2.71E+00
Lateral sclerosis	8B60.4	Cervical spinal cord	8.32E-01	4.74E-02	1.73E-01
Liver cancer	2C12.0	Liver tissue	1.02E-14	-3.12E+00	-2.25E+00
Liver failure	DB99.7-DB99.8	Liver tissue	1.05E-04	-3.19E+00	-2.66E+00
Lung cancer	2C25	Lung tissue	5.59E-39	-3.76E-01	-1.64E+00
Lupus erythematosus	4A40	Whole blood	5.35E-05	-1.56E-01	-4.11E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	6.06E-01	-2.42E-02	-1.64E-01
Major depressive disorder	6A70-6A7Z	Whole blood	2.17E-01	-5.18E-02	-2.74E-01
Melanoma	2C30	Skin	2.19E-08	-5.72E-01	-1.61E+00
Multiple myeloma	2A83.1	Peripheral blood	2.51E-01	8.39E-02	5.00E-01
Multiple myeloma	2A83.1	Bone marrow	1.93E-04	-6.16E-01	-2.64E+00
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	9.85E-01	2.24E-02	7.33E-02
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	4.73E-01	-1.99E-02	-1.18E-01
Myelofibrosis	2A20.2	Whole blood	5.97E-01	-3.21E-02	-2.80E-01
Myocardial infarction	BA41-BA50	Peripheral blood	5.97E-01	5.39E-02	1.24E-01
Myopathy	8C70.6	Muscle tissue	3.95E-02	-2.34E-01	-1.05E+00
Neonatal sepsis	KA60	Whole blood	6.57E-01	-3.39E-02	-1.45E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	5.34E-04	-6.64E-01	-1.63E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	6.18E-01	-6.23E-02	-1.75E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	7.38E-02	-1.12E-01	-1.78E+00
Olive pollen allergy	CA08.00	Peripheral blood	2.89E-01	9.67E-02	4.76E-01
Oral cancer	2B6E	Oral tissue	3.71E-03	-3.53E-01	-9.10E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	8.33E-01	1.48E-01	3.59E-01
Osteoporosis	FB83.1	Bone marrow	8.60E-02	1.58E-01	1.36E+00
Ovarian cancer	2C73	Ovarian tissue	2.96E-01	-3.35E-01	-1.10E+00
Pancreatic cancer	2C10	Pancreas	8.64E-01	-2.20E-01	-5.34E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	1.76E-01	1.26E-01	8.27E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	1.52E-01	-1.33E-01	-5.91E-01
Pituitary cancer	2D12	Pituitary tissue	4.87E-01	-2.28E-01	-4.52E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	9.30E-01	2.02E-01	5.47E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	5.86E-01	7.97E-02	6.52E-01
Polycythemia vera	2A20.4	Whole blood	2.87E-01	-7.38E-02	-6.14E-01
Pompe disease	5C51.3	Biceps muscle	4.85E-01	-1.24E-01	-8.96E-01
Preterm birth	KA21.4Z	Myometrium	1.76E-01	-2.60E-02	-3.37E-01
Prostate cancer	2C82	Prostate	1.10E-01	-1.23E-01	-2.88E-01
Psoriasis	EA90	Skin	8.67E-01	-3.83E-03	-1.24E-02
Rectal cancer	2B92	Rectal colon tissue	3.90E-02	-3.45E-01	-1.49E+00
Renal cancer	2C90-2C91	Kidney	5.84E-01	-1.61E-01	-3.61E-01
Retinoblastoma	2D02.2	Uvea	7.95E-02	-1.55E-01	-1.24E+00
Rheumatoid arthritis	FA20	Synovial tissue	9.81E-01	2.72E-01	6.95E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	8.32E-01	-1.56E-02	-1.09E-01
Schizophrenia	6A20	Prefrontal cortex	4.66E-01	4.25E-02	1.20E-01
Schizophrenia	6A20	Superior temporal cortex	4.75E-01	5.15E-02	3.64E-01
Scleroderma	4A42.Z	Whole blood	8.95E-01	-4.05E-02	-2.35E-01
Seizure	8A60-8A6Z	Whole blood	6.30E-01	-2.96E-02	-1.60E-01
Sensitive skin	EK0Z	Skin	5.32E-02	-3.50E-01	-1.37E+00
Sepsis with septic shock	1G41	Whole blood	5.10E-04	6.44E-02	2.85E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	1.23E-01	4.92E-01	1.13E+00
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	5.21E-01	1.33E-01	8.26E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	6.80E-01	-9.44E-03	-8.86E-02
Sjogren's syndrome	4A43.2	Salivary gland tissue	2.99E-01	-2.06E-01	-1.70E+00
Skin cancer	2C30-2C3Z	Skin	1.29E-36	-3.75E-01	-1.06E+00
Thrombocythemia	3B63	Whole blood	4.50E-03	-5.35E-02	-4.77E-01
Thrombocytopenia	3B64	Whole blood	8.21E-01	-1.09E-01	-6.81E-01
Thyroid cancer	2D10	Thyroid	1.75E-01	3.78E-02	1.44E-01
Tibial muscular dystrophy	8C75	Muscle tissue	7.93E-02	-8.20E-02	-8.93E-01
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	9.01E-01	6.22E-02	5.20E-01
Type 2 diabetes	5A11	Liver tissue	2.76E-01	-4.64E-01	-9.16E-01
Ureter cancer	2C92	Urothelium	6.69E-01	2.43E-02	7.51E-02
Uterine cancer	2C78	Endometrium tissue	2.20E-02	-1.08E-01	-2.31E-01
Vitiligo	ED63.0	Skin	1.70E-01	2.10E-01	5.81E-01

The Drug Therapeutic Target (DTT) Role of This DME

• DME DTT Name: Albendazole monooxygenase (CYP3A4) DTT Info
• DME DTT Type: Clinical trial

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Curcumin	DMQPH29	Solid tumour/cancer	2A00-2F9Z	Phase 3	[1]
PMX-53	DMZUAJ4	Atopic dermatitis	EA80	Phase 2	[2]

64 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(-)-clusin	DMPGJE6	Discovery agent	N.A.	Investigative	[3]
(-)-cubebin	DM57LVW	Discovery agent	N.A.	Investigative	[3]
(-)-cubebinin	DMSTZF9	Discovery agent	N.A.	Investigative	[3]
(-)-cubebininolide	DM8Q6I0	Discovery agent	N.A.	Investigative	[3]
(-)-dihydroclusin	DMNYH3X	Discovery agent	N.A.	Investigative	[3]
(-)-thujaplicatintrimethyl ether	DMKWIYP	Discovery agent	N.A.	Investigative	[3]
(-)-yatein	DMDHGIR	Discovery agent	N.A.	Investigative	[3]
(5-pyridin-3-yl-furan-2-yl)methanethiol	DMKC2BE	Discovery agent	N.A.	Investigative	[4]
(8R,8'R)-4-hydroxycubebinone	DM1UGQN	Discovery agent	N.A.	Investigative	[3]
(8R,8'R,9'S)-5-methoxyclusin	DMVIHTF	Discovery agent	N.A.	Investigative	[3]
1,1':4',1''-terphenyl-3,3''-diol	DMGHAC7	Discovery agent	N.A.	Investigative	[5]
1,2-Diacetoxylycorine	DMBAX2L	Discovery agent	N.A.	Investigative	[6]
1-(3,4-DICHLOROPHENYL)-6-(METHOXYMETHYL)-3-AZABICYCLO[4.1.0]HEPTANE (ENANTIOMERIC MIX)	DMYZ548	Discovery agent	N.A.	Investigative	[7]
1-(4-Butoxy-phenyl)-1H-imidazole	DMOEGZV	Discovery agent	N.A.	Investigative	[8]
1-(METHOXYMETHYL)-6-(NAPHTHALEN-2-YL)-3-AZABICYCLO[4.1.0]HEPTANE (ENANTIOMERIC MIX)	DMI479T	Discovery agent	N.A.	Investigative	[7]
1-Acetoxy-2-tert-butyldimethylsilyl-oxylycorine	DM7DL03	Discovery agent	N.A.	Investigative	[6]
1-Acetoxylycorine	DMQH1MS	Discovery agent	N.A.	Investigative	[6]
1H-1,2,3-benzotriazol-1-amine	DM9KAI5	Discovery agent	N.A.	Investigative	[9]
2,5-bis(4-hydroxybenzylidene)cyclopentanone	DMOQPHK	Discovery agent	N.A.	Investigative	[1]
2-(2-(4-tert-Butylphenylthio)ethyl)-1H-imidazole	DMZVBPG	Discovery agent	N.A.	Investigative	[10]
2-(4-Imidazol-1-yl-phenoxymethyl)-pyridine	DMUIVS9	Discovery agent	N.A.	Investigative	[8]
2-Fluoro-4-[5-(3-hydroxyphenyl)-2-thienyl]phenol	DMUGAT8	Discovery agent	N.A.	Investigative	[11]
2-fluoro-5-(3-methylthiophen-2-yl)pyridine	DMCGI1S	Discovery agent	N.A.	Investigative	[4]
2-tert-Butyldimethylsilyloxylycorine	DMFAV5R	Discovery agent	N.A.	Investigative	[6]
2-[3-(4-Imidazol-1-yl-phenoxy)-propyl]-pyridine	DM8A3NI	Discovery agent	N.A.	Investigative	[8]
3,3-(1,3-Thiazole-2,5-diyl)diphenol	DMQY50A	Discovery agent	N.A.	Investigative	[5]
3-(3-methylthiophen-2-yl)pyridine	DMHU9V5	Discovery agent	N.A.	Investigative	[4]
3-(5-((methylthio)methyl)furan-2-yl)pyridine	DM6S28U	Discovery agent	N.A.	Investigative	[4]
3-(5-[1,3]dithiolan-2-yl-furan-2-yl)pyridine	DMOUNPH	Discovery agent	N.A.	Investigative	[4]
3-(pyridin-3-yl)prop-2-yn-1-amine	DM3EDQ1	Discovery agent	N.A.	Investigative	[4]
3-methoxy-5-(6-methoxynaphthalen-2-yl)pyridine	DMF2IW8	Discovery agent	N.A.	Investigative	[12]
3-[3-(4-Imidazol-1-yl-phenoxy)-propyl]-pyridine	DMTLJMF	Discovery agent	N.A.	Investigative	[8]
3-[3-(4-Methoxybenzyl)naphthalen-2-yl]pyridine	DM8NRJQ	Discovery agent	N.A.	Investigative	[13]
3-[5-(4-Hydroxyphenyl)-3-thienyl]phenol	DM40GJ8	Discovery agent	N.A.	Investigative	[5]
4-(6-Methoxynaphthalen-2-yl)isoquinoline	DM51XDA	Discovery agent	N.A.	Investigative	[12]
4-[2-(4-Imidazol-1-yl-phenoxy)-ethyl]-morpholine	DM9UGO0	Discovery agent	N.A.	Investigative	[8]
4-[3-(4-Imidazol-1-yl-phenoxy)-propyl]-pyridine	DM7LV5A	Discovery agent	N.A.	Investigative	[8]
4-[5-(3-Hydroxyphenyl)-2-thienyl)-2-methyl]phenol	DMK4ICB	Discovery agent	N.A.	Investigative	[11]
4-[5-(3-Hydroxyphenyl)-3-thienyl]-2-methylphenol	DM7ERYJ	Discovery agent	N.A.	Investigative	[11]
5-(2-phenethylpiperazin-1-yl)-1H-indazole	DM07P5E	Discovery agent	N.A.	Investigative	[14]
5-Pyridin-3-yl-thiophene-2-carbaldehyde oxime	DMZQPTU	Discovery agent	N.A.	Investigative	[15]
6-(3,4-DICHLOROPHENYL)-1-[1-(METHYLOXY)-3-BUTEN-1-YL]-3-AZABICYCLO[4.1.0]HEPTANE (DIASTEREOMERIC MIX)	DMZHFWX	Discovery agent	N.A.	Investigative	[7]
6-(3-Hydroxy-phenyl)-naphthalen-2-ol	DMH8WA2	Discovery agent	N.A.	Investigative	[16]
6-Pyridin-3-yl-3,4-dihydronaphthalen-2(1H)-one	DMIM5DL	Discovery agent	N.A.	Investigative	[17]
Alpha-Hydroxy-Midazolam	DMAQBKX	Discovery agent	N.A.	Investigative	[18]
Alpha-methylcubebin	DM0C4GP	Discovery agent	N.A.	Investigative	[3]
BERGAPTOL	DMDITNB	Discovery agent	N.A.	Investigative	[19]
BMS-536924	DMXJB4N	Discovery agent	N.A.	Investigative	[20]
DIETHOXYFLOURESCEIN	DMK7QXA	Discovery agent	N.A.	Investigative	[21]
DIHYDROCUBEBIN	DMZL7R6	Discovery agent	N.A.	Investigative	[3]
ETHOXYCLUSIN	DM1MGTX	Discovery agent	N.A.	Investigative	[3]
Geranylcoumarin	DMRPWGL	Discovery agent	N.A.	Investigative	[19]
Go-Y026	DMUNSLJ	Discovery agent	N.A.	Investigative	[1]
GSK-8062	DMGW42V	Discovery agent	N.A.	Investigative	[22]
Heme	DMGC287	Discovery agent	N.A.	Investigative	[23]
Hinokinin	DMD6NZO	Discovery agent	N.A.	Investigative	[3]
JATRORRHIZINE	DMYFNW9	Discovery agent	N.A.	Investigative	[24]
MEDIORESINOL	DMDJ6RE	Discovery agent	N.A.	Investigative	[3]
Methyl-(5-pyridin-3-yl-thiophen-2-yl)-amine	DMQU9VD	Discovery agent	N.A.	Investigative	[15]
ML-3163	DM3S5UC	Discovery agent	N.A.	Investigative	[25]
ML-3375	DMXJY6W	Discovery agent	N.A.	Investigative	[25]
ML-3403	DMTQWI8	Discovery agent	N.A.	Investigative	[25]
PALMATINE	DMJCOKV	Discovery agent	N.A.	Investigative	[24]
TILIROSIDE	DMLNTB5	Discovery agent	N.A.	Investigative	[26]

References

• [1] Structure-activity relationships for the inhibition of recombinant human cytochromes P450 by curcumin analogues. Eur J Med Chem. 2008 Aug;43(8):1621-31.
• [2] Peptidomimetic C5a receptor antagonists with hydrophobic substitutions at the C-terminus: increased receptor specificity and in vivo activity. Bioorg Med Chem Lett. 2006 Oct 1;16(19):5088-92.
• [3] Potent CYP3A4 inhibitory constituents of Piper cubeba. J Nat Prod. 2005 Jan;68(1):64-8.
• [4] Synthetic inhibitors of cytochrome P-450 2A6: inhibitory activity, difference spectra, mechanism of inhibition, and protein cocrystallization. J Med Chem. 2006 Nov 30;49(24):6987-7001.
• [5] Design, synthesis, biological evaluation and pharmacokinetics of bis(hydroxyphenyl) substituted azoles, thiophenes, benzenes, and aza-benzenes as p... J Med Chem. 2008 Nov 13;51(21):6725-39.
• [6] Selective cytochrome P450 3A4 inhibitory activity of Amaryllidaceae alkaloids. Bioorg Med Chem Lett. 2009 Jun 15;19(12):3233-7.
• [7] 6-(3,4-dichlorophenyl)-1-[(methyloxy)methyl]-3-azabicyclo[4.1.0]heptane: a new potent and selective triple reuptake inhibitor. J Med Chem. 2010 Jul 8;53(13):4989-5001.
• [8] Imidazole derivatives as new potent and selective 20-HETE synthase inhibitors. Bioorg Med Chem Lett. 2004 Jan 19;14(2):333-6.
• [9] Discovery of a N'-hydroxyphenylformamidine derivative HET0016 as a potent and selective 20-HETE synthase inhibitor. Bioorg Med Chem Lett. 2001 Dec 3;11(23):2993-5.
• [10] Role of hydrophobic substituents on the terminal nitrogen of histamine in receptor binding and agonist activity: development of an orally active hi... J Med Chem. 2010 May 13;53(9):3840-4.
• [11] New insights into the SAR and binding modes of bis(hydroxyphenyl)thiophenes and -benzenes: influence of additional substituents on 17beta-hydroxyst... J Med Chem. 2009 Nov 12;52(21):6724-43.
• [12] Overcoming undesirable CYP1A2 inhibition of pyridylnaphthalene-type aldosterone synthase inhibitors: influence of heteroaryl derivatization on pote... J Med Chem. 2008 Aug 28;51(16):5064-74.
• [13] Novel aldosterone synthase inhibitors with extended carbocyclic skeleton by a combined ligand-based and structure-based drug design approach. J Med Chem. 2008 Oct 9;51(19):6138-49.
• [14] 2-Substituted N-aryl piperazines as novel triple reuptake inhibitors for the treatment of depression, Bioorg. Med. Chem. Lett. 20(13):3941-3945 (2010).
• [15] 5-substituted, 6-substituted, and unsubstituted 3-heteroaromatic pyridine analogues of nicotine as selective inhibitors of cytochrome P-450 2A6. J Med Chem. 2005 Jan 13;48(1):224-39.
• [16] Design, synthesis, and biological evaluation of (hydroxyphenyl)naphthalene and -quinoline derivatives: potent and selective nonsteroidal inhibitors... J Med Chem. 2008 Apr 10;51(7):2158-69.
• [17] In vivo active aldosterone synthase inhibitors with improved selectivity: lead optimization providing a series of pyridine substituted 3,4-dihydro-... J Med Chem. 2008 Dec 25;51(24):8077-87.
• [18] Design and synthesis of a new fluorescent probe for cytochrome P450 3A4 (CYP 3A4). Bioorg Med Chem Lett. 2003 Nov 3;13(21):3643-5.
• [19] Radical scavenging and cytochrome P450 3A4 inhibitory activity of bergaptol and geranylcoumarin from grapefruit. Bioorg Med Chem. 2007 Jun 1;15(11):3684-91.
• [20] Discovery and evaluation of 4-(2-(4-chloro-1H-pyrazol-1-yl)ethylamino)-3-(6-(1-(3-fluoropropyl)piperidin-4-yl)-4-methyl-1H-benzo[d]imidazol-2-yl)py... J Med Chem. 2008 Oct 9;51(19):5897-900.
• [21] Exploration of the amine terminus in a novel series of 1,2,4-triazolo-3-yl-azabicyclo[3.1.0]hexanes as selective dopamine D3 receptor antagonists. J Med Chem. 2010 Oct 14;53(19):7129-39.
• [22] Conformationally constrained farnesoid X receptor (FXR) agonists: Naphthoic acid-based analogs of GW 4064. Bioorg Med Chem Lett. 2008 Aug 1;18(15):4339-43.
• [23] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [24] Cytochrome P3A4 inhibitors and other constituents of Fibraurea tinctoria. J Nat Prod. 2007 Dec;70(12):1930-3.
• [25] Novel substituted pyridinyl imidazoles as potent anticytokine agents with low activity against hepatic cytochrome P450 enzymes. J Med Chem. 2003 Jul 17;46(15):3230-44.
• [26] Isolation of cytochrome P450 inhibitors from strawberry fruit, Fragaria ananassa. J Nat Prod. 2004 Nov;67(11):1839-41.
• [27] Abiraterone for the treatment of metastatic castrate-resistant prostate cancer. Ann Pharmacother. 2012 Jul-Aug;46(7-8):1016-24.
• [28] FDA label of Acalabrutinib. The 2020 official website of the U.S. Food and Drug Administration.
• [29] Possible interaction between topical terbinafine and acenocoumarol. Ann Pharmacother. 2009 Nov;43(11):1911-2.
• [30] Metabolic interactions between acetaminophen (paracetamol) and two flavonoids, luteolin and quercetin, through in-vitro inhibition studies. J Pharm Pharmacol. 2017 Dec;69(12):1762-1772.
• [31] Kinetic characterization and identification of the enzymes responsible for the hepatic biotransformation of adinazolam and N-desmethyladinazolam in man. J Pharm Pharmacol. 1998 Mar;50(3):265-74.
• [32] Identification of human cytochrome P(450)s that metabolise anti-parasitic drugs and predictions of in vivo drug hepatic clearance from in vitro data. Eur J Clin Pharmacol. 2003 Sep;59(5-6):429-42.
• [33] Prediction of cytochrome P450 isoform responsible for metabolizing a drug molecule. BMC Pharmacol. 2010 Jul 16;10:8.
• [34] Aldosterone receptor antagonists: effective but often forgotten. Circulation. 2010 Feb 23;121(7):934-9.
• [35] In vitro metabolism of alectinib, a novel potent ALK inhibitor, in human: contribution of CYP3A enzymes. Xenobiotica. 2018 Jun;48(6):546-554.
• [36] Pharmacogenetic determinants of human liver microsomal alfentanil metabolism and the role of cytochrome P450 3A5. Anesthesiology. 2005 Mar;102(3):550-6.
• [37] Clinical pharmacokinetics and pharmacodynamics of aliskiren. Clin Pharmacokinet. 2008;47(8):515-31.
• [38] Alitretinoin in dermatology-an update. Indian J Dermatol. 2015 Sep-Oct;60(5):520.
• [39] Clinical pharmacokinetics of almotriptan, a serotonin 5-HT(1B/1D) receptor agonist for the treatment of migraine. Clin Pharmacokinet. 2005;44(3):237-46.
• [40] An update on the clinical pharmacology of the dipeptidyl peptidase 4 inhibitor alogliptin used for the treatment of type 2 diabetes mellitus. Clin Exp Pharmacol Physiol. 2015 Dec;42(12):1225-38.
• [41] Effect of alosetron on the pharmacokinetics of alprazolam. J Clin Pharmacol. 2001 Apr;41(4):452-4.
• [42] Comparison of 19F NMR and 14C measurements for the assessment of ADME of BYL719 (Alpelisib) in humans. Drug Metab Dispos. 2017 Aug;45(8):900-907.
• [43] No relevant interaction with alprazolam, caffeine, tolbutamide, and digoxin by treatment with a low-hyperforin St John's wort extract. Planta Med. 2005 Apr;71(4):331-7.
• [44] Clinical pharmacokinetics and drug-drug interactions of endothelin receptor antagonists in pulmonary arterial hypertension. J Clin Pharmacol. 2012 Dec;52(12):1784-805.
• [45] Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
• [46] Regulation of drug-metabolizing cytochrome P450 enzymes by glucocorticoids. Drug Metab Rev. 2010 Nov;42(4):621-35.
• [47] The metabolism of amiodarone by various CYP isoenzymes of human and rat, and the inhibitory influence of ketoconazole. J Pharm Pharm Sci. 2008;11(1):147-59.
• [48] Bioactivation of the tricyclic antidepressant amitriptyline and its metabolite nortriptyline to arene oxide intermediates in human liver microsomes and recombinant P450s. Chem Biol Interact. 2008 May 9;173(1):59-67.
• [49] Amlodipine metabolism in human liver microsomes and roles of CYP3A4/5 in the dihydropyridine dehydrogenation. Drug Metab Dispos. 2014 Feb;42(2):245-9.
• [50] Differential inhibition of cytochrome P450 3A4, 3A5 and 3A7 by five human immunodeficiency virus (HIV) protease inhibitors in vitro. Basic Clin Pharmacol Toxicol. 2006 Jan;98(1):79-85.
• [51] In vitro and in vivo oxidative metabolism and glucuronidation of anastrozole. Br J Clin Pharmacol. 2010 Dec;70(6):854-69.
• [52] In vitro assessment of metabolic drug-drug interaction potential of apixaban through cytochrome P450 phenotyping, inhibition, and induction studies. Drug Metab Dispos. 2010 Mar;38(3):448-58.
• [53] Apremilast, an oral phosphodiesterase 4 (PDE4) inhibitor: a novel treatment option for nurse practitioners treating patients with psoriatic disease. J Am Assoc Nurse Pract. 2016 Dec;28(12):683-695.
• [54] Lack of effect of aprepitant on the pharmacokinetics of docetaxel in cancer patients. Cancer Chemother Pharmacol. 2005 Jun;55(6):609-16.
• [55] Assessment of the potential pharmacokinetic and pharmacodynamic interactions between erythromycin and argatroban. J Clin Pharmacol. 1999 May;39(5):513-9.
• [56] Aripiprazole: a review of its use in schizophrenia and schizoaffective disorder. Drugs. 2004;64(15):1715-36.
• [57] Interaction profile of armodafinil with medications metabolized by cytochrome P450 enzymes 1A2, 3A4 and 2C19 in healthy subjects. Clin Pharmacokinet. 2008;47(1):61-74.
• [58] Apalutamide: first global approval. Drugs. 2018 Apr;78(6):699-705.
• [59] The effect of grapefruit juice on the time-dependent decline of artemether plasma levels in healthy subjects. Clin Pharmacol Ther. 1999 Oct;66(4):408-14.
• [60] Antimalarial artemisinin drugs induce cytochrome P450 and MDR1 expression by activation of xenosensors pregnane X receptor and constitutive androstane receptor. Mol Pharmacol. 2005 Jun;67(6):1954-65.
• [61] Asenapine for the treatment of manic and mixed episodes associated with bipolar I disorder: from clinical research to clinical practice. Expert Opin Pharmacother. 2013 Mar;14(4):489-504.
• [62] Atazanavir: effects on P-glycoprotein transport and CYP3A metabolism in vitro. Drug Metab Dispos. 2005 Jun;33(6):764-70.
• [63] Metabolism of atenolol in man. Xenobiotica. 1978 May;8(5):313-20.
• [64] Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
• [65] Time-dependent pharmacokinetics and drug metabolism of atovaquone plus proguanil (Malarone) when taken as chemoprophylaxis. Eur J Clin Pharmacol. 2002 Apr;58(1):19-27.
• [66] An update on pharmacological treatment of erectile dysfunction with phosphodiesterase type 5 inhibitors. Expert Opin Pharmacother. 2013 Jul;14(10):1333-44.
• [67] Clinical pharmacology of axitinib. Clin Pharmacokinet. 2013 Sep;52(9):713-25.
• [68] In vitro identification of the human cytochrome P-450 enzymes involved in the N-demethylation of azelastine. Drug Metab Dispos. 1999 Aug;27(8):942-6.
• [69] Aztreonam decreases hepatic microsomal cytochrome P450 in cynomolgus monkeys. Pharmacology. 1994 Mar;48(3):137-42.
• [70] FDA Label of Baloxavir marboxil. The 2020 official website of the U.S. Food and Drug Administration.
• [71] FDA label of Baricitinib. The 2020 official website of the U.S. Food and Drug Administration.
• [72] FDA label of Copanlisib. The 2020 official website of the U.S. Food and Drug Administration.
• [73] Metabolism of beclomethasone dipropionate by cytochrome P450 3A enzymes. J Pharmacol Exp Ther. 2013 May;345(2):308-16.
• [74] Bedaquiline metabolism: enzymes and novel metabolites. Drug Metab Dispos. 2014 May;42(5):863-6.
• [75] Identification of the human and animal hepatic cytochromes P450 involved in clonazepam metabolism. Fundam Clin Pharmacol. 1993;7(2):69-75.
• [76] Integrated analysis on the physicochemical properties of dihydropyridine calcium channel blockers in grapefruit juice interactions. Curr Pharm Biotechnol. 2012 Jul;13(9):1705-17.
• [77] Studies on Drug Interactions between CYP3A4 Inhibitors and Glucocorticoids.
• [78] Clinical pharmacokinetics of fibric acid derivatives (fibrates). Clin Pharmacokinet. 1998 Feb;34(2):155-62.
• [79] Bicalutamide: clinical pharmacokinetics and metabolism. Clin Pharmacokinet. 2004;43(13):855-78.
• [80] Product monograph: LUMIGAN RC (Bimatoprost).
• [81] Stereoselective metabolism of bisoprolol enantiomers in dogs and humans. Life Sci. 1998;63(13):1097-108.
• [82] Pharmacokinetic evaluation of the interaction between hepatitis C virus protease inhibitor boceprevir and 3-hydroxy-3-methylglutaryl coenzyme A reductase inhibitors atorvastatin and pravastatin. Antimicrob Agents Chemother. 2013 Jun;57(6):2582-8.
• [83] Relative contributions of the five major human cytochromes P450, 1A2, 2C9, 2C19, 2D6, and 3A4, to the hepatic metabolism of the proteasome inhibitor bortezomib. Drug Metab Dispos. 2005 Nov;33(11):1723-8.
• [84] Bosentan is a substrate of human OATP1B1 and OATP1B3: inhibition of hepatic uptake as the common mechanism of its interactions with cyclosporin A, rifampicin, and sildenafil. Drug Metab Dispos. 2007 Aug;35(8):1400-7.
• [85] In vitro assessment of time-dependent inhibitory effects on CYP2C8 and CYP3A activity by fourteen protein kinase inhibitors. Drug Metab Dispos. 2014 Jul;42(7):1202-9.
• [86] Brentuximab vedotin.
• [87] Absorption, distribution, metabolism, and excretion of ticagrelor in healthy subjects. Drug Metab Dispos. 2010 Sep;38(9):1514-21.
• [88] Kinetics of dithionite-dependent reduction of cytochrome P450 3A4: heterogeneity of the enzyme caused by its oligomerization. Biochemistry. 2005 Oct 25;44(42):13902-13.
• [89] CYP3A is responsible for N-dealkylation of haloperidol and bromperidol and oxidation of their reduced forms by human liver microsomes. Life Sci. 2000 Nov 3;67(24):2913-20.
• [90] No relevant effect of ursodeoxycholic acid on cytochrome P450 3A metabolism in primary biliary cirrhosis. Hepatology. 2005 Mar;41(3):595-602.
• [91] Oxidative metabolism of bupivacaine into pipecolylxylidine in humans is mainly catalyzed by CYP3A. Drug Metab Dispos. 2000 Apr;28(4):383-5.
• [92] Drug interactions of clinical importance among the opioids, methadone and buprenorphine, and other frequently prescribed medications: a review. Am J Addict. 2010 Jan-Feb;19(1):4-16.
• [93] Effects of cytochrome P450 (CYP) 3A4 inhibitors on the anxiolytic action of tandospirone in rat contextual conditioned fear. Prog Neuropsychopharmacol Biol Psychiatry. 2007 May 9;31(4):926-31.
• [94] Update: clinically significant cytochrome P-450 drug interactions. Pharmacotherapy. 1998 Jan-Feb;18(1):84-112.
• [95] DAILYMED.nlm.nih.gov: JEVTANA- cabazitaxel kit.
• [96] Receptor-binding and pharmacokinetic properties of dopaminergic agonists. Curr Top Med Chem. 2008;8(12):1049-67.
• [97] Practical management of adverse events associated with cabozantinib treatment in patients with renal-cell carcinoma. Onco Targets Ther. 2017 Oct 19;10:5053-5064.
• [98] Effect of cytochrome P450 (CYP) inducers on caffeine metabolism in the rat. Pharmacol Rep. 2007 May-Jun;59(3):296-305.
• [99] Intestinal and hepatic CYP3A4 catalyze hydroxylation of 1alpha,25-dihydroxyvitamin D(3): implications for drug-induced osteomalacia. Mol Pharmacol. 2006 Jan;69(1):56-65.
• [100] Sodium-glucose linked transporter 2 (SGLT2) inhibitors in the management of type-2 diabetes: a drug class overview. P T. 2015 Jul;40(7):451-62.
• [101] Molecular targets of cannabidiol in neurological disorders. Neurotherapeutics. 2015 Oct;12(4):699-730.
• [102] Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49.
• [103] Carbamazepine pharmacokinetics are not affected by zonisamide: in vitro mechanistic study and in vivo clinical study in epileptic patients. Epilepsy Res. 2004 Nov;62(1):1-11.
• [104] Cariprazine: chemistry, pharmacodynamics, pharmacokinetics, and metabolism, clinical efficacy, safety, and tolerability. Expert Opin Drug Metab Toxicol. 2013 Feb;9(2):193-206.
• [105] Role of cytochrome P450 2D6 genetic polymorphism in carvedilol hydroxylation in vitro. Drug Des Devel Ther. 2016 Jun 8;10:1909-16.
• [106] Major role of human liver microsomal cytochrome P450 2C9 (CYP2C9) in the oxidative metabolism of celecoxib, a novel cyclooxygenase-II inhibitor. J Pharmacol Exp Ther. 2000 May;293(2):453-9.
• [107] FDA label of Cenobamate. The 2020 official website of the U.S. Food and Drug Administration.
• [108] Transport and metabolic characterization of Caco-2 cells expressing CYP3A4 and CYP3A4 plus oxidoreductase. Pharm Res. 1999 Sep;16(9):1352-9.
• [109] Pharmacokinetics and metabolism of the novel muscarinic receptor agonist SNI-2011 in rats and dogs. Arzneimittelforschung. 2003;53(1):26-33.
• [110] Identification of human hepatic cytochrome p450 enzymes involved in the biotransformation of cholic and chenodeoxycholic acid. Drug Metab Dispos. 2008 Oct;36(10):1983-91.
• [111] Cytochrome P450 2C8 and CYP3A4/5 are involved in chloroquine metabolism in human liver microsomes. Arch Pharm Res. 2003 Aug;26(8):631-7.
• [112] Drug Interactions Flockhart Table
• [113] Effect of classic and atypical neuroleptics on cytochrome P450 3A (CYP3A) in rat liver. Pharmacol Rep. 2012;64(6):1411-8.
• [114] Identification of enzymes involved in phase I metabolism of ciclesonide by human liver microsomes. Eur J Drug Metab Pharmacokinet. 2005 Oct-Dec;30(4):275-86.
• [115] Dasatinib significantly reduced in vivo exposure to cyclosporine in a rat model: The possible involvement of CYP3A induction. Pharmacol Rep. 2019 Apr;71(2):201-205.
• [116] Effects of CYP3A inhibition on the metabolism of cilostazol. Clin Pharmacokinet. 1999;37 Suppl 2:61-8.
• [117] Clinical pharmacokinetic and pharmacodynamic profile of cinacalcet hydrochloride. Clin Pharmacokinet. 2009;48(5):303-11.
• [118] Cisapride: a potential model substrate to assess cytochrome P4503A4 activity in vivo. Clin Pharmacol Ther. 2003 Mar;73(3):209-22.
• [119] PharmGKB summary: citalopram pharmacokinetics pathway. Pharmacogenet Genomics. 2011 Nov;21(11):769-72.
• [120] Pharmacokinetic variability of clarithromycin and differences in CYP3A4 activity in patients with cystic fibrosis. J Cyst Fibros. 2014 Mar;13(2):179-85.
• [121] In vitro metabolism of clindamycin in human liver and intestinal microsomes. Drug Metab Dispos. 2003 Jul;31(7):878-87.
• [122] In vitro characterization of clobazam metabolism by recombinant cytochrome P450 enzymes: importance of CYP2C19. Drug Metab Dispos. 2004 Nov;32(11):1279-86.
• [123] CYP2D6 mediates 4-hydroxylation of clonidine in vitro: implication for pregnancy-induced changes in clonidine clearance. Drug Metab Dispos. 2010 Sep;38(9):1393-6.
• [124] In vitro drug allergy detection system incorporating human liver microsomes in chlorazepate-induced skin rash: drug-specific proliferation associated with interleukin-5 secretion. Br J Dermatol. 2001 Feb;144(2):316-20.
• [125] Contribution of human hepatic cytochrome p450 isoforms to the metabolism of psychotropic drugs. Biol Pharm Bull. 2005 Sep;28(9):1711-6.
• [126] Tacrolimus interaction with clotrimazole: a concise case report and literature review. P T. 2010 Oct;35(10):568-9.
• [127] Drug metabolism and atypical antipsychotics. Eur Neuropsychopharmacol. 1999 Jun;9(4):301-9.
• [128] Drug interactions between hormonal contraceptives and antiretrovirals. AIDS. 2017 Apr 24;31(7):917-952.
• [129] Drug-drug interactions for UDP-glucuronosyltransferase substrates: a pharmacokinetic explanation for typically observed low exposure (AUCi/AUC) ratios. Drug Metab Dispos. 2004 Nov;32(11):1201-8.
• [130] Colchicine down-regulates cytochrome P450 2B6, 2C8, 2C9, and 3A4 in human hepatocytes by affecting their glucocorticoid receptor-mediated regulation. Mol Pharmacol. 2003 Jul;64(1):160-9.
• [131] Conivaptan: a dual vasopressin receptor v1a/v2 antagonist [corrected]. Cardiovasc Drug Rev. 2007 Fall;25(3):261-79.
• [132] Conjugated oestrogens/bazedoxifene. Aust Prescr. 2017 Jun;40(3):114-115.
• [133] Microsomal catalyzed N-hydroxylation of guanfacine and reduction of N-hydroxyguanfacine. Arch Pharm (Weinheim). 1997 Oct;330(9-10):303-6.
• [134] Troglitazone induces CYP3A4 activity leading to falsely abnormal dexamethasone suppression test. J Clin Endocrinol Metab. 2003 Jul;88(7):3113-6.
• [135] Prediction of tacrolimus metabolism and dosage requirements based on CYP3A4 phenotype and CYP3A5(*)3 genotype in Chinese renal transplant recipients. Acta Pharmacol Sin. 2016 Apr;37(4):555-60.
• [136] Crizotinib for the treatment of non-small-cell lung cancer. Am J Health Syst Pharm. 2013 Jun 1;70(11):943-7.
• [137] Identification of human liver cytochrome P450 isoforms involved in the in vitro metabolism of cyclobenzaprine. Drug Metab Dispos. 1996 Jul;24(7):786-91.
• [138] Effects of ketoconazole on cyclophosphamide metabolism: evaluation of CYP3A4 inhibition effect using the in vitro and in vivo models. Exp Anim. 2018 Feb 9;67(1):71-82.
• [139] Synthesis and characterization of a novel liver-targeted prodrug of cytosine-1-beta-D-arabinofuranoside monophosphate for the treatment of hepatocellular carcinoma. J Med Chem. 2006 Dec 28;49(26):7711-20.
• [140] Physiologically based pharmacokinetic modeling to identify physiological and molecular characteristics driving variability in drug exposure. Clin Pharmacol Ther. 2018 Dec;104(6):1219-1228.
• [141] Daclatasvir: a NS5A replication complex inhibitor for hepatitis C infection. Ann Pharmacother. 2016 Jan;50(1):39-46.
• [142] Phase 1 study to investigate the pharmacokinetic properties of dacomitinib in healthy adult Chinese subjects genotyped for CYP2D6. Xenobiotica. 2018 May;48(5):459-466.
• [143] Clinical pharmacokinetics and pharmacodynamics of dapagliflozin, a selective inhibitor of sodium-glucose co-transporter type 2. Clin Pharmacokinet. 2014 Jan;53(1):17-27.
• [144] Metabolic interactions of putative cytochrome P4503A substrates with alternative pathways of dapsone metabolism in human liver microsomes. Drug Metab Dispos. 1996 Feb;24(2):164-171.
• [145] The clinical pharmacokinetics of darifenacin. Clin Pharmacokinet. 2006;45(4):325-50.
• [146] Drug-drug interaction potential of darolutamide: in vitro and clinical studies. Eur J Drug Metab Pharmacokinet. 2019 Dec;44(6):747-759.
• [147] Drug interactions with new and investigational antiretrovirals. Clin Pharmacokinet. 2009;48(4):211-41.
• [148] Clinical pharmacokinetics of tyrosine kinase inhibitors. Cancer Treat Rev. 2009 Dec;35(8):692-706.
• [149] The effect of new lipophilic chelators on the activities of cytosolic reductases and P450 cytochromes involved in the metabolism of anthracycline antibiotics: studies in vitro. Physiol Res. 2004;53(6):683-91.
• [150] Mechanisms and clinical significance of pharmacokinetic-based drug-drug interactions with drugs approved by the U.S. Food and Drug Administration in 2017. Drug Metab Dispos. 2019 Feb;47(2):135-144.
• [151] Pharmacokinetics and metabolism of delamanid, a novel anti-tuberculosis drug, in animals and humans: importance of albumin metabolism in vivo. Drug Metab Dispos. 2015 Aug;43(8):1267-76.
• [152] Delavirdine: clinical pharmacokinetics and drug interactions. Clin Pharmacokinet. 2001;40(3):207-26.
• [153] Variability in metabolism of imipramine and desipramine using urinary excretion data. J Anal Toxicol. 2014 Jul-Aug;38(6):368-74.
• [154] The role of CYP2C and CYP3A in the disposition of 3-keto-desogestrel after administration of desogestrel. Br J Clin Pharmacol. 2005 Jul;60(1):69-75.
• [155] Progress in Brain Research. Chapter 11 - Steroidogenic Enzymes in the Brain: Morphological Aspects. 2010, 181:193-207.
• [156] Desvenlafaxine in the treatment of major depressive disorder. Expert Opin Pharmacother. 2011 Dec;12(18):2923-8.
• [157] Identification of drugs inhibiting the in vitro metabolism of tacrolimus by human liver microsomes. Br J Clin Pharmacol. 1996 Mar;41(3):187-90.
• [158] Absorption, distribution, metabolism and excretion of [14C]dexlansoprazole in healthy male subjects. Clin Drug Investig. 2012 May 1;32(5):319-32.
• [159] Comparative contribution to dextromethorphan metabolism by cytochrome P450 isoforms in vitro: can dextromethorphan be used as a dual probe for both CTP2D6 and CYP3A activities? Drug Metab Dispos. 2001 Nov;29(11):1514-20.
• [160] CYP3A4 mediates dextropropoxyphene N-demethylation to nordextropropoxyphene: human in vitro and in vivo studies and lack of CYP2D6 involvement. Xenobiotica. 2004 Oct;34(10):875-87.
• [161] Comparative study of the metabolism of drug substrates by human cytochrome P450 3A4 expressed in bacterial, yeast and human lymphoblastoid cells. Xenobiotica. 2002 Nov;32(11):937-47.
• [162] Cytochrome P450 3A4-mediated interaction of diclofenac and quinidine. Drug Metab Dispos. 2000 Sep;28(9):1043-50.
• [163] Comparative analysis of human CYP3A4 and rat CYP3A1 induction and relevant gene expression by bisphenol A and diethylstilbestrol: implications for toxicity testing paradigms. Reprod Toxicol. 2013 Jun;37:24-30.
• [164] Prevalence of non-cytochrome P450-mediated metabolism in food and drug administration-approved oral and intravenous drugs: 2006-2015. Drug Metab Dispos. 2016 Aug;44(8):1246-52.
• [165] Species differences in the toxicity and cytochrome P450 IIIA-dependent metabolism of digitoxin. Mol Pharmacol. 1991 Nov;40(5):859-67.
• [166] Omeprazole-associated digoxin toxicity. South Med J. 2007 Apr;100(4):400-2.
• [167] Mechanism-based inhibition of cytochrome P450 3A4 by therapeutic drugs. Clin Pharmacokinet. 2005;44(3):279-304.
• [168] CYP2D6 and CYP3A4 involvement in the primary oxidative metabolism of hydrocodone by human liver microsomes. Br J Clin Pharmacol. 2004 Mar;57(3):287-97.
• [169] Comparative metabolic capabilities of CYP3A4, CYP3A5, and CYP3A7. Drug Metab Dispos. 2002 Aug;30(8):883-91.
• [170] Drug-Drug interactions of clinical significance in the treatment of patients with Mycobacterium avium complex disease. Clin Pharmacokinet. 2000 Sep;39(3):203-14.
• [171] Species difference in stereoselective involvement of CYP3A in the mono-N-dealkylation of disopyramide. Xenobiotica. 2001 Feb;31(2):73-83.
• [172] Interaction of disulfiram with antiretroviral medications: efavirenz increases while atazanavir decreases disulfiram effect on enzymes of alcohol metabolism. Am J Addict. 2014 Mar-Apr;23(2):137-44.
• [173] Randomized pharmacokinetic and pharmacodynamic study of docetaxel: dosing based on body-surface area compared with individualized dosing based on cytochrome P450 activity estimated using a urinary metabolite of exogenous cortisol. J Clin Oncol. 2005 Feb 20;23(6):1061-9.
• [174] Significance of metabolism in the disposition and action of the antidysrhythmic drug, dofetilide. In vitro studies and correlation with in vivo data. Drug Metab Dispos. 1996 Apr;24(4):447-55.
• [175] Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of dolasetron. Comparison with other indole-containing 5-HT3 antagonists. Drug Metab Dispos. 1996 May;24(5):602-9.
• [176] Mechanisms of action, pharmacology and interactions of dolutegravir. Enferm Infecc Microbiol Clin. 2015 Mar;33 Suppl 1:2-8.
• [177] Characterization of CYP3A isozymes involved in the metabolism of domperidone: role of cytochrome b5 and inhibition by ketoconazole. Drug Metab Lett. 2010 Apr;4(2):95-103.
• [178] Donepezil plasma concentrations, CYP2D6 and CYP3A4 phenotypes, and cognitive outcome in Alzheimer's disease. Eur J Clin Pharmacol. 2016 Jun;72(6):711-7.
• [179] Population pharmacokinetics of doxapram in low-birth-weight Japanese infants with apnea. Eur J Pediatr. 2015 Apr;174(4):509-18.
• [180] Priapism induced by boceprevir-CYP3A4 inhibition and alpha-adrenergic blockade: case report. Clin Infect Dis. 2014 Jan;58(1):e35-8.
• [181] The N-demethylation of the doxepin isomers is mainly catalyzed by the polymorphic CYP2C19. Pharm Res. 2002 Jul;19(7):1034-7.
• [182] Expression levels and activation of a PXR variant are directly related to drug resistance in osteosarcoma cell lines. Cancer. 2007 Mar 1;109(5):957-65.
• [183] A further interaction study of quinine with clinically important drugs by human liver microsomes: determinations of inhibition constant (Ki) and type of inhibition. Eur J Drug Metab Pharmacokinet. 1999 Jul-Sep;24(3):272-8.
• [184] Drug safety evaluation of dronedarone in atrial fibrillation. Expert Opin Drug Saf. 2012 Nov;11(6):1023-45.
• [185] Role of CYP3A in oral contraceptives clearance. Clin Transl Sci. 2018 May;11(3):251-260.
• [186] Edoxaban drug-drug interactions with ketoconazole, erythromycin, and cyclosporine. Br J Clin Pharmacol. 2016 Dec;82(6):1591-1600.
• [187] Dydrogesterone metabolism in human liver by aldo-keto reductases and cytochrome P450 enzymes. Xenobiotica. 2016 Oct;46(10):868-74.
• [188] The clinical pharmacology profile of the new antiepileptic drug perampanel: A novel noncompetitive AMPA receptor antagonist. Epilepsia. 2015 Jan;56(1):12-27.
• [189] Induction of CYP3A4 by efavirenz in primary human hepatocytes: comparison with rifampin and phenobarbital. J Clin Pharmacol. 2004 Nov;44(11):1273-81.
• [190] Clinical pharmacokinetics and drug-drug interactions of Elbasvir/Grazoprevir. Eur J Drug Metab Pharmacokinet. 2018 Oct;43(5):509-531.
• [191] FDA Label of Elvitegravir. The 2020 official website of the U.S. Food and Drug Administration.
• [192] Metabolism of ipecac alkaloids cephaeline and emetine by human hepatic microsomal cytochrome P450s, and their inhibitory effects on P450 enzyme activities. Biol Pharm Bull. 2001 Jun;24(6):678-82.
• [193] Entrectinib: first global approval. Drugs. 2019 Sep;79(13):1477-1483.
• [194] Metabolism of epinastine, a histamine H1 receptor antagonist, in human liver microsomes in comparison with that of terfenadine. Res Commun Mol Pathol Pharmacol. 1997 Dec;98(3):273-92.
• [195] Eplerenone: a selective aldosterone receptor antagonist for hypertension and heart failure. Heart Dis. 2003 Sep-Oct;5(5):354-63.
• [196] FDA label of Erdafitinib. The 2020 official website of the U.S. Food and Drug Administration.
• [197] CYP3A4 is a human microsomal vitamin D 25-hydroxylase. J Bone Miner Res. 2004 Apr;19(4):680-8.
• [198] Rational prescription of drugs within similar therapeutic or structural class for gastrointestinal disease treatment: drug metabolism and its related interactions. World J Gastroenterol. 2007 Nov 14;13(42):5618-28.
• [199] Modulation of cytochrome P450 metabolism by ergonovine and dihydroergotamine. Vet Hum Toxicol. 2003 Feb;45(1):6-9.
• [200] Atazanavir for the treatment of human immunodeficiency virus infection. Pharmacotherapy. 2004 Dec;24(12):1732-47.
• [201] Delineation of the interactions between the chemotherapeutic agent eribulin mesylate (E7389) and human CYP3A4. Cancer Chemother Pharmacol. 2008 Sep;62(4):707-16.
• [202] Effect of the CYP3A4 inhibitor erythromycin on the pharmacokinetics of lignocaine and its pharmacologically active metabolites in subjects with normal and impaired liver function. Br J Clin Pharmacol. 2003 Jan;55(1):86-93.
• [203] Identification of human cytochrome P450 enzymes involved in the formation of 4-hydroxyestazolam from estazolam. Xenobiotica. 2005 May;35(5):455-65.
• [204] Isoform-specific regulation of cytochromes P450 expression by estradiol and progesterone. Drug Metab Dispos. 2013 Feb;41(2):263-9.
• [205] A potential role for the estrogen-metabolizing cytochrome P450 enzymes in human breast carcinogenesis. Breast Cancer Res Treat. 2003 Dec;82(3):191-7.
• [206] Activity of docetaxel with or without estramustine phosphate versus mitoxantrone in androgen dependent and independent human prostate cancer xenografts. J Urol. 2003 May;169(5):1729-34.
• [207] Regioselective hydroxylation of steroid hormones by human cytochromes P450. Drug Metab Rev. 2015 May;47(2):89-110.
• [208] Estrogen regulation of the cytochrome P450 3A subfamily in humans. J Pharmacol Exp Ther. 2004 Nov;311(2):728-35.
• [209] Alkylation of the prosthetic heme in cytochrome P-450 during oxidative metabolism of the sedative-hypnotic ethchlorvynol. J Med Chem. 1982 Oct;25(10):1174-9.
• [210] Rifampicin, a keystone inducer of drug metabolism: from Herbert Remmer's pioneering ideas to modern concepts. Drug Metab Rev. 2004 Oct;36(3-4):497-509.
• [211] Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of ethosuximide by human hepatic microsomal enzymes. Xenobiotica. 2003 Mar;33(3):265-76.
• [212] News and information in drug research: Ethynodiol diacetate.
• [213] Effects of morin on the pharmacokinetics of etoposide in rats. Biopharm Drug Dispos. 2007 Apr;28(3):151-6.
• [214] Role of human liver cytochrome P4503A in the metabolism of etoricoxib, a novel cyclooxygenase-2 selective inhibitor. Drug Metab Dispos. 2001 Jun;29(6):813-20.
• [215] Pharmacokinetic interactions between etravirine and non-antiretroviral drugs. Clin Pharmacokinet. 2011 Jan;50(1):25-39.
• [216] The evolving experience using everolimus in clinical transplantation. Transplant Proc. 2004 Mar;36(2 Suppl):495S-499S.
• [217] In vitro metabolism of exemestane by hepatic cytochrome P450s: impact of nonsynonymous polymorphisms on formation of the active metabolite 17beta-dihydroexemestane. Pharmacol Res Perspect. 2017 Apr 27;5(3):e00314.
• [218] Ezetimibe: a review of its metabolism, pharmacokinetics and drug interactions. Clin Pharmacokinet. 2005;44(5):467-94.
• [219] Evidence that famciclovir (BRL 42810) and its associated metabolites do not inhibit the 6 beta-hydroxylation of testosterone in human liver microsomes. Drug Metab Dispos. 1993 Jan-Feb;21(1):18-23.
• [220] FDA label of Fedratinib. The 2020 official website of the U.S. Food and Drug Administration.
• [221] A mechanistic approach to antiepileptic drug interactions. Ann Pharmacother. 1998 May;32(5):554-63.
• [222] Drug interactions with calcium channel blockers: possible involvement of metabolite-intermediate complexation with CYP3A. Drug Metab Dispos. 2000 Feb;28(2):125-30.
• [223] Three-dimensional-quantitative structure activity relationship analysis of cytochrome P-450 3A4 substrates. J Pharmacol Exp Ther. 1999 Oct;291(1):424-33.
• [224] Effects of the moderate CYP3A4 inhibitor, fluconazole, on the pharmacokinetics of fesoterodine in healthy subjects. Br J Clin Pharmacol. 2011 Aug;72(2):263-9.
• [225] Flibanserin: first global approval. Drugs. 2015 Oct;75(15):1815-22.
• [226] Characterization of kinetics of human cytochrome P450s involved in bioactivation of flucloxacillin: inhibition of CYP3A-catalysed hydroxylation by sulfaphenazole. Br J Pharmacol. 2019 Feb;176(3):466-477.
• [227] Metabolic pathways of inhaled glucocorticoids by the CYP3A enzymes. Drug Metab Dispos. 2013 Feb;41(2):379-89.
• [228] Cytochrome P450 3A4 and benzodiazepines. Seishin Shinkeigaku Zasshi. 2003;105(5):631-42.
• [229] O-Dealkylation of fluoxetine in relation to CYP2C19 gene dose and involvement of CYP3A4 in human liver microsomes. J Pharmacol Exp Ther. 2002 Jan;300(1):105-11.
• [230] Effect of dexamethasone on cytochrome P-450 mediated metabolism of 2-acetylaminofluorene in cultured rat hepatocytes. Biochem Pharmacol. 1987 Jan 15;36(2):237-43.
• [231] NCIthesaurus: Fluprednisolone
• [232] Is 1-aminobenzotriazole an appropriate in vitro tool as a nonspecific cytochrome P450 inactivator? Drug Metab Dispos. 2009 Jan;37(1):10-3.
• [233] Identification of a novel glutathione conjugate of flutamide in incubations with human liver microsomes. Drug Metab Dispos. 2007 Jul;35(7):1081-8.
• [234] Effects of fluvastatin on the pharmacokinetics of eepaglinide: possible role of CYP3A4 and P-glycoprotein inhibition by fluvastatin. Korean J Physiol Pharmacol. 2013 Jun;17(3):245-51.
• [235] Fosamprenavir : clinical pharmacokinetics and drug interactions of the amprenavir prodrug. Clin Pharmacokinet. 2006;45(2):137-68.
• [236] Basic review of the cytochrome p450 system. J Adv Pract Oncol. 2013 Jul;4(4):263-8.
• [237] Effects of CYP3A4 inhibitors ketoconazole and verapamil and the CYP3A4 inducer rifampicin on the pharmacokinetic parameters of fostamatinib: results from In vitro and phase I clinical studies. Drugs R D. 2016 Mar;16(1):81-92.
• [238] Fulvestrant: pharmacologic profile versus existing endocrine agents for the treatment of breast cancer. Ann Pharmacother. 2006 Sep;40(9):1572-83.
• [239] Clinical pharmacokinetics of galantamine. Clin Pharmacokinet. 2003;42(15):1383-92.
• [240] Differential metabolism of gefitinib and erlotinib by human cytochrome P450 enzymes. Clin Cancer Res. 2007 Jun 15;13(12):3731-7.
• [241] Adverse drug interactions: a handbook for prescribers. Taylor and Francis group.2010.
• [242] ClinicalTrials.gov (NCT02456883) Study to Investigate the Absorption, Metabolism and Excretion of [14C] ASP2215 in Patients With Advanced Solid Tumors.
• [243] The pharmacological interactions between direct-acting antivirals for the treatment of chronic hepatitis c and psychotropic drugs. Expert Rev Clin Pharmacol. 2018 Oct;11(10):999-1030.
• [244] Repaglinide : a pharmacoeconomic review of its use in type 2 diabetes mellitus. Pharmacoeconomics. 2004;22(6):389-411.
• [245] CYP1A1 is a major enzyme responsible for the metabolism of granisetron in human liver microsomes. Curr Drug Metab. 2005 Oct;6(5):469-80.
• [246] MDR- and CYP3A4-mediated drug-drug interactions. J Neuroimmune Pharmacol. 2006 Sep;1(3):323-39.
• [247] Eribulin, a microtubule inhibitor for metastatic breast cancer. Oncology (Williston Park). 2011 Feb;25(2 Suppl Nurse Ed):46-8.
• [248] NCIthesaurus: Halcinonide
• [249] Pharmacokinetic and pharmacodynamic interaction between grapefruit juice and halofantrine. Clin Pharmacol Ther. 2002 Nov;72(5):514-23.
• [250] Assessment of the contributions of CYP3A4 and CYP3A5 in the metabolism of the antipsychotic agent haloperidol to its potentially neurotoxic pyridinium metabolite and effect of antidepressants on the bioactivation pathway. Drug Metab Dispos. 2003 Mar;31(3):243-9.
• [251] Human reductive halothane metabolism in vitro is catalyzed by cytochrome P450 2A6 and 3A4. Drug Metab Dispos. 1996 Sep;24(9):976-83.
• [252] Cytochrome P450 isozymes involved in propranolol metabolism in human liver microsomes. The role of CYP2D6 as ring-hydroxylase and CYP1A2 as N-desisopropylase. Drug Metab Dispos. 1994 Nov-Dec;22(6):909-15.
• [253] The effect of CYP2D6 drug-drug interactions on hydrocodone effectiveness. Acad Emerg Med. 2014 Aug;21(8):879-85.
• [254] Regulation of the CYP3A4 gene by hydrocortisone and xenobiotics: role of the glucocorticoid and pregnane X receptors. Drug Metab Dispos. 2000 May;28(5):493-6.
• [255] Capillary electrophoresis contributions to the hydromorphone metabolism in man. Electrophoresis. 2006 Jun;27(12):2444-57.
• [256] Metabolism of (S)-5,6-difluoro-4-cyclopropylethynyl-4-trifluoromethyl-3, 4-dihydro-2(1H)-quinazolinone, a non-nucleoside reverse transcriptase inhibitor, in human liver microsomes. Metabolic activation and enzyme kinetics. Drug Metab Dispos. 2003 Jan;31(1):122-32.
• [257] Stereoselective method development and validation for determination of concentrations of amphetamine-type stimulants and metabolites in human urine using a simultaneous extraction-chiral derivatization approach. J Chromatogr B Analyt Technol Biomed Life Sci. 2011 Jan 1;879(1):8-16.
• [258] Hydroxychloroquine: a physiologically-based pharmacokinetic model in the context of cancer-related autophagy modulation. J Pharmacol Exp Ther. 2018 Jun;365(3):447-459.
• [259] Prevention of preterm delivery with 17-hydroxyprogesterone caproate: pharmacologic considerations. Semin Perinatol. 2014 Dec;38(8):516-22.
• [260] Product characteristics of HYDROXYZINE (Hydroxyzine Hydrochloride Capsules).
• [261] Absorption, metabolism, and excretion of oral 14C radiolabeled ibrutinib: an open-label, phase I, single-dose study in healthy men. Drug Metab Dispos. 2015 Feb;43(2):289-97.
• [262] PharmGKB summary: ibuprofen pathways. Pharmacogenet Genomics. 2015 Feb;25(2):96-106.
• [263] FDA label of Idelalisib. The 2020 official website of the U.S. Food and Drug Administration.
• [264] Influences of CYP2D6*10 polymorphisms on the pharmacokinetics of iloperidone and its metabolites in Chinese patients with schizophrenia: a population pharmacokinetic analysis. Acta Pharmacol Sin. 2016 Nov;37(11):1499-1508.
• [265] Potent mechanism-based inhibition of CYP3A4 by imatinib explains its liability to interact with CYP3A4 substrates. Br J Pharmacol. 2012 Apr;165(8):2787-98.
• [266] Use of indacaterol for the treatment of COPD: a pharmacokinetic evaluation. Expert Opin Drug Metab Toxicol. 2014 Jan;10(1):129-37.
• [267] Dehydrogenation of the indoline-containing drug 4-chloro-N-(2-methyl-1-indolinyl)-3-sulfamoylbenzamide (indapamide) by CYP3A4: correlation with in silico predictions. Drug Metab Dispos. 2009 Mar;37(3):672-84.
• [268] Pharmacokinetics of ipriflavone and metabolites after oral administration of a corn-oil suspension relative to the Osteofix tablet. Am J Ther. 1997 Jul-Aug;4(7-8):229-38.
• [269] Drug interactions with irbesartan. Clin Pharmacokinet. 2001;40(8):605-14.
• [270] Irinotecan and its active metabolite, SN-38: review of bioanalytical methods and recent update from clinical pharmacology perspectives. Biomed Chromatogr. 2010 Jan;24(1):104-23.
• [271] Isavuconazole: pharmacology, pharmacodynamics, and current clinical experience with a new triazole antifungal agent. Pharmacotherapy. 2015 Nov;35(11):1037-51.
• [272] Isoforms of cytochrome P450 on organic nitrate-derived nitric oxide release in human heart vessels. FEBS Lett. 1999 Jun 11;452(3):165-9.
• [273] The effect of isotretinoin on the pharmacokinetics and pharmacodynamics of ethinyl estradiol and norethindrone. Clin Pharmacol Ther. 2004 May;75(5):464-75.
• [274] Effects of rifampin on the pharmacokinetics of a single dose of istradefylline in healthy subjects. J Clin Pharmacol. 2018 Feb;58(2):193-201.
• [275] Effects of itraconazole and tandospirone on the pharmacokinetics of perospirone. Ther Drug Monit. 2006 Feb;28(1):73-5.
• [276] Ivabradine: new drug. Best avoided in stable angina. Prescrire Int. 2007 Apr;16(88):53-6.
• [277] Sensitivity of ivacaftor to drug-drug interactions with rifampin, a cytochrome P450 3A4 inducer. Pediatr Pulmonol. 2018 May;53(5):E6-E8.
• [278] Identification of cytochrome P4503A4 as the major enzyme responsible for the metabolism of ivermectin by human liver microsomes. Xenobiotica. 1998 Mar;28(3):313-21.
• [279] The effect of ketoconazole on the pharmacokinetics and pharmacodynamics of ixabepilone: a first in class epothilone B analogue in late-phase clinical development. Clin Cancer Res. 2008 May 1;14(9):2701-9.
• [280] Contribution of CYP3A4, CYP2B6, and CYP2C9 isoforms to N-demethylation of ketamine in human liver microsomes. Drug Metab Dispos. 2002 Jul;30(7):853-8.
• [281] Ketobemidone is a substrate for cytochrome P4502C9 and 3A4, but not for P-glycoprotein. Xenobiotica. 2005 Aug;35(8):785-96.
• [282] An evaluation of the cytochrome P450 induction potential of pantoprazole in primary human hepatocytes. Chem Biol Interact. 1998 Jul 3;114(1-2):1-13.
• [283] Mechanism-based inactivation of cytochrome P450 3A4 by lapatinib. Mol Pharmacol. 2010 Oct;78(4):693-703.
• [284] Lefamulin: review of a promising novel pleuromutilin antibiotic. Pharmacotherapy. 2018 Sep;38(9):935-946.
• [285] Prediction of drug-induced liver injury in HepG2 cells cultured with human liver microsomes. Chem Res Toxicol. 2015 May 18;28(5):872-85.
• [286] Lercanidipine in hypertension. Vasc Health Risk Manag. 2005;1(3):173-82.
• [287] Inhibition of drug metabolizing cytochrome P450s by the aromatase inhibitor drug letrozole and its major oxidative metabolite 4,4'-methanol-bisbenzonitrile in vitro. Cancer Chemother Pharmacol. 2009 Oct;64(5):867-75.
• [288] Clinical profile of levobupivacaine in regional anesthesia: A systematic review. J Anaesthesiol Clin Pharmacol. 2013 Oct;29(4):530-9.
• [289] FDA label of Levocetirizine dihydrochloride. The 2020 official website of the U.S. Food and Drug Administration.
• [290] Paradoxical role of cytochrome P450 3A in the bioactivation and clinical effects of levo-alpha-acetylmethadol: importance of clinical investigations to validate in vitro drug metabolism studies. Clin Pharmacokinet. 2005;44(7):731-51.
• [291] [Metabolic interaction between psychopharmaceuticals. Probable cause of exacerbation of hypothyroidism according to a case report]. Lakartidningen. 2002 Jun 20;99(25):2854-6.
• [292] Development of encorafenib for BRAF-mutated advanced melanoma. Curr Opin Oncol. 2018 Mar;30(2):125-133.
• [293] Pharmacokinetics of lidocaine hydrochloride metabolized by CYP3A4 in Chinese Han volunteers living at low altitude and in native Han and Tibetan Chinese volunteers living at high altitude. Pharmacology. 2016;97(3-4):107-13.
• [294] A basic conceptual and practical overview of interactions with highly prescribed drugs. Can J Clin Pharmacol. 2002 Winter;9(4):191-8.
• [295] Stable expression of human cytochrome P450 3A4 in V79 cells and its application for metabolic profiling of ergot derivatives. Eur J Pharmacol. 1995 Oct 6;293(3):183-90.
• [296] Lack of the effect of lobeglitazone, a peroxisome proliferator-activated receptor-gamma agonist, on the pharmacokinetics and pharmacodynamics of warfarin. Drug Des Devel Ther. 2015 Mar 2;9:737-43.
• [297] Evaluation of the effects of the weak CYP3A inhibitors atorvastatin and ethinyl estradiol/norgestimate on lomitapide pharmacokinetics in healthy subjects. J Clin Pharmacol. 2016 Jan;56(1):47-55.
• [298] Identification of human liver cytochrome P450 enzymes responsible for the metabolism of lonafarnib (Sarasar). Drug Metab Dispos. 2006 Apr;34(4):628-35.
• [299] Loperamide: a pharmacological review. Rev Gastroenterol Disord. 2007;7 Suppl 3:S11-8.
• [300] Synthesis and antiviral activities of the major metabolites of the HIV protease inhibitor ABT-378 (Lopinavir). Bioorg Med Chem Lett. 2001 Jun 4;11(11):1351-3.
• [301] Identification of human cytochrome P450 and flavin-containing monooxygenase enzymes involved in the metabolism of lorcaserin, a novel selective human 5-hydroxytryptamine 2C agonist. Drug Metab Dispos. 2012 Apr;40(4):761-71.
• [302] FDA label of Lorlatinib. The 2020 official website of the U.S. Food and Drug Administration.
• [303] EMC: Lotemax 0.5% w/v Eye Drops, Suspension.
• [304] Metabolic interactions with statins. Tidsskr Nor Laegeforen. 2001 Jan 20;121(2):189-93.
• [305] In vitro identification of the human cytochrome p450 enzymes involved in the oxidative metabolism of loxapine. Biopharm Drug Dispos. 2011 Oct;32(7):398-407.
• [306] Development of a paediatric physiologically based pharmacokinetic model to assess the impact of drug-drug interactions in tuberculosis co-infected malaria subjects: A case study with artemether-lumefantrine and the CYP3A4-inducer rifampicin. Eur J Pharm Sci. 2017 Aug 30;106:20-33.
• [307] Pharmacokinetics and pharmacodynamics of lurasidone hydrochloride, a second-generation antipsychotic: a systematic review of the published literature. Clin Pharmacokinet. 2017 May;56(5):493-503.
• [308] LiverTox: Clinical and Research Information on Drug-Induced Liver Injury [Internet]-Abemaciclib.
• [309] Investigation of the effects of ketoconazole on the pharmacokinetics of macitentan, a novel dual endothelin receptor antagonist, in healthy subjects. Clin Pharmacokinet. 2013 Aug;52(8):685-92.
• [310] Alveolar echinococcosis of the liver in an adult with human immunodeficiency virus type-1 infection. Infection. 2004 Oct;32(5):299-302.
• [311] Metabolic profiling and cytochrome P450 reaction phenotyping of medroxyprogesterone acetate. Drug Metab Dispos. 2008 Nov;36(11):2292-8.
• [312] Effect of rifampin on plasma concentrations of mefloquine in healthy volunteers. J Pharm Pharmacol. 2000 Oct;52(10):1265-9.
• [313] Metabolism of megestrol acetate in vitro and the role of oxidative metabolites. Xenobiotica. 2018 Oct;48(10):973-983.
• [314] Activation of human cytochrome P-450 3A4-catalyzed meloxicam 5'-methylhydroxylation by quinidine and hydroquinidine in vitro. J Pharmacol Exp Ther. 1999 Jul;290(1):1-8.
• [315] Is meperidine the drug that just won't die? J Pediatr Pharmacol Ther. 2011 Jul;16(3):167-9.
• [316] Species differences in stereoselective metabolism of mephenytoin by cytochrome P450 (CYP2C and CYP3A). J Pharmacol Exp Ther. 1993 Jan;264(1):89-94.
• [317] Prescribrt's digital referenve - Ethinyl estradiol/norethindrone; mestranol/norethindrone - Drug Summary
• [318] Methadone metabolism and drug-drug interactions: in vitro and in vivo literature review. J Pharm Sci. 2018 Dec;107(12):2983-2991.
• [319] Photochemotherapeutic agent 8-methoxypsoralen induces cytochrome P450 3A4 and carboxylesterase HCE2: evidence on an involvement of the pregnane X receptor. Toxicol Sci. 2007 Jan;95(1):13-22.
• [320] Identification of cytochrome P450 2E1 as the predominant enzyme catalyzing human liver microsomal defluorination of sevoflurane, isoflurane, and methoxyflurane. Anesthesiology. 1993 Oct;79(4):795-807.
• [321] Cytochrome P450 enzyme regulation by glucocorticoids and consequences in terms of drug interaction. Expert Opin Drug Metab Toxicol. 2014 Mar;10(3):425-35.
• [322] Metabolism of anabolic steroids by recombinant human cytochrome P450 enzymes. Gas chromatographic-mass spectrometric determination of metabolites. J Chromatogr B Biomed Sci Appl. 1999 Nov 26;735(1):73-83.
• [323] Metoclopramide is metabolized by CYP2D6 and is a reversible inhibitor, but not inactivator, of CYP2D6. Xenobiotica. 2014 Apr;44(4):309-319.
• [324] Chemical stability-indicating HPLC study of fixed-dosage combination containing metoprolol tartrate and hydrochlorothiazide.
• [325] Does metronidazole interact with CYP3A substrates by inhibiting their metabolism through this metabolic pathway? Or should other mechanisms be considered? Ann Pharmacother. 2007 Apr;41(4):653-8.
• [326] Pharmacokinetic and pharmacodynamic interaction between mexiletine and propafenone in human beings. Clin Pharmacol Ther. 2000 Jul;68(1):44-57.
• [327] Inhibition of cytochrome P450 enzymes participating in p-nitrophenol hydroxylation by drugs known as CYP2E1 inhibitors. Chem Biol Interact. 2004 Apr 15;147(3):331-40.
• [328] Selection of alternative CYP3A4 probe substrates for clinical drug interaction studies using in vitro data and in vivo simulation. Drug Metab Dispos. 2010 Jun;38(6):981-7.
• [329] Midostaurin, a novel protein kinase inhibitor for the treatment of acute myelogenous leukemia: insights from human absorption, metabolism, and excretion studies of a BDDCS II drug. Drug Metab Dispos. 2017 May;45(5):540-555.
• [330] Evaluation of strategies for the assessment of drug-drug interactions involving cytochrome P450 enzymes. Eur J Drug Metab Pharmacokinet. 2018 Dec;43(6):737-750.
• [331] Role of cytochrome p450 isoenzymes 3A and 2D6 in the in vivo metabolism of mirabegron, a beta-3-adrenoceptor agonist. Clin Drug Investig. 2013 Jun;33(6):429-40.
• [332] A review of the pharmacological and clinical profile of mirtazapine. CNS Drug Rev. 2001 Fall;7(3):249-64.
• [333] Characterisation of the absorption, distribution, metabolism, excretion and mass balance of doravirine, a non-nucleoside reverse transcriptase inhibitor in humans. Xenobiotica. 2019 Apr;49(4):422-432.
• [334] Modulation of UDP-glucuronosyltransferase 2B7 function by cytochrome P450s in vitro: differential effects of CYP1A2, CYP2C9 and CYP3A4. Biol Pharm Bull. 2005 Oct;28(10):2026-7.
• [335] PharmGKB summary: mycophenolic acid pathway. Pharmacogenet Genomics. 2014 Jan;24(1):73-9.
• [336] Naloxegol: treatment for opioid-induced constipation in chronic non-cancer pain. Ann Pharmacother. 2015 Mar;49(3):360-5.
• [337] Drug-drug and food-drug pharmacokinetic interactions with new insulinotropic agents repaglinide and nateglinide. Clin Pharmacokinet. 2007;46(2):93-108.
• [338] Nefazodone, meta-chlorophenylpiperazine, and their metabolites in vitro: cytochromes mediating transformation, and P450-3A4 inhibitory actions. Psychopharmacology (Berl). 1999 Jul;145(1):113-22.
• [339] Characterization of the in vitro biotransformation of the HIV-1 reverse transcriptase inhibitor nevirapine by human hepatic cytochromes P-450. Drug Metab Dispos. 1999 Dec;27(12):1488-95.
• [340] Inhibitory effects of nicardipine to cytochrome P450 (CYP) in human liver microsomes. Biol Pharm Bull. 2005 May;28(5):882-5.
• [341] Roles of CYP2A6 and CYP2B6 in nicotine C-oxidation by human liver microsomes. Arch Toxicol. 1999 Mar;73(2):65-70.
• [342] Metabolic interactions of selected antimalarial and non-antimalarial drugs with the major pathway (3-hydroxylation) of quinine in human liver microsomes. Br J Clin Pharmacol. 1997 Nov;44(5):505-11.
• [343] Drug interactions with the tyrosine kinase inhibitors imatinib, dasatinib, and nilotinib. Blood. 2011 Feb 24;117(8):e75-87.
• [344] Prediction of metabolic clearance using fresh human hepatocytes: comparison with cryopreserved hepatocytes and hepatic microsomes for five benzodiazepines. Xenobiotica. 2008 Apr;38(4):353-67.
• [345] Identification of the human cytochrome P450 enzymes involved in the in vitro biotransformation of lynestrenol and norethindrone. J Steroid Biochem Mol Biol. 2008 May;110(1-2):56-66.
• [346] Metabolite identification, reaction phenotyping, and retrospective drug-drug interaction predictions of 17-deacetylnorgestimate, the active component of the oral contraceptive norgestimate. Drug Metab Dispos. 2017 Jun;45(6):676-685.
• [347] Cytochrome P-450 activities in human and rat brain microsomes. Brain Res. 2000 Feb 14;855(2):235-43.
• [348] Progestogens in menopausal hormone therapy. Prz Menopauzalny. 2015 Jun;14(2):134-43.
• [349] Extent of radiosensitization by the PARP inhibitor olaparib depends on its dose, the radiation dose and the integrity of the homologous recombination pathway of tumor cells. Radiother Oncol. 2015 Sep;116(3):358-65.
• [350] Effects of olopatadine, a new antiallergic agent, on human liver microsomal cytochrome P450 activities. Drug Metab Dispos. 2002 Dec;30(12):1504-11.
• [351] The effect of rifampin on the pharmacokinetics of oral and intravenous ondansetron. Clin Pharmacol Ther. 1999 Apr;65(4):377-81.
• [352] Brexpiprazole: first global approval. Drugs. 2015 Sep;75(14):1687-97.
• [353] Effect of ketoconazole on the pharmacokinetics of ornidazole--a possible role of p-glycoprotein and CYP3A. Drug Metabol Drug Interact. 2006;22(1):67-77.
• [354] Orphenadrine and methimazole inhibit multiple cytochrome P450 enzymes in human liver microsomes. Drug Metab Dispos. 1997 Mar;25(3):390-3.
• [355] Ospemifene metabolism in humans in vitro and in vivo: metabolite identification, quantitation, and CYP assignment of major hydroxylations. Drug Metabol Drug Interact. 2013;28(3):153-61.
• [356] Identification of human P450 isoforms involved in the metabolism of the antiallergic drug, oxatomide, and its kinetic parameters and inhibition constants. Biol Pharm Bull. 2005 Feb;28(2):328-34.
• [357] Bioreactor systems in drug metabolism: synthesis of cytochrome P450-generated metabolites. Metab Eng. 2000 Apr;2(2):115-25.
• [358] A comparative review of oxybutynin chloride formulations: pharmacokinetics and therapeutic efficacy in overactive bladder. Rev Urol. 2010 Winter;12(1):12-9.
• [359] Exposure to oral oxycodone is increased by concomitant inhibition of CYP2D6 and 3A4 pathways, but not by inhibition of CYP2D6 alone. Br J Clin Pharmacol. 2010 Jul;70(1):78-87.
• [360] Progress with palbociclib in breast cancer: latest evidence and clinical considerations. Ther Adv Med Oncol. 2017 Feb;9(2):83-105.
• [361] ABCB1 polymorphisms influence steady-state plasma levels of 9-hydroxyrisperidone and risperidone active moiety. Ther Drug Monit. 2008 Oct;30(5):628-33.
• [362] Pharmacokinetics, metabolism and excretion of intravenous [l4C]-palonosetron in healthy human volunteers. Biopharm Drug Dispos. 2004 Nov;25(8):329-37.
• [363] Panobinostat for the treatment of relapsed or relapsed/refractory multiple myeloma: pharmacology and clinical outcomes. Expert Rev Clin Pharmacol. 2016;9(1):35-48.
• [364] Interaction of proton pump inhibitors with cytochromes P450: consequences for drug interactions. Yale J Biol Med. 1996 May-Jun;69(3):203-9.
• [365] Involvement of cytochrome P450 2C9, 2E1 and 3A4 in trimethadione N-demethylation in human microsomes. J Clin Pharm Ther. 2003 Dec;28(6):493-6.
• [366] New orally active anticoagulant agents for the prevention and treatment of venous thromboembolism in cancer patients. Ther Clin Risk Manag. 2014 Jun 13;10:423-36.
• [367] Pazopanib, a new therapy for metastatic soft tissue sarcoma. Expert Opin Pharmacother. 2013 May;14(7):929-35.
• [368] The metabolism of the piperazine-type phenothiazine neuroleptic perazine by the human cytochrome P-450 isoenzymes. Eur Neuropsychopharmacol. 2004 May;14(3):199-208.
• [369] CYP2B6, CYP2D6, and CYP3A4 catalyze the primary oxidative metabolism of perhexiline enantiomers by human liver microsomes. Drug Metab Dispos. 2007 Jan;35(1):128-38.
• [370] Human metabolic interactions of environmental chemicals. J Biochem Mol Toxicol. 2007;21(4):182-6.
• [371] Identification of the human cytochrome P450 isoforms mediating in vitro N-dealkylation of perphenazine. Br J Clin Pharmacol. 2000 Dec;50(6):563-71.
• [372] An evaluation of potential mechanism-based inactivation of human drug metabolizing cytochromes P450 by monoamine oxidase inhibitors, including isoniazid. Br J Clin Pharmacol. 2006 May;61(5):570-84.
• [373] Clinically important drug interactions potentially involving mechanism-based inhibition of cytochrome P450 3A4 and the role of therapeutic drug monitoring. Ther Drug Monit. 2007 Dec;29(6):687-710.
• [374] Identification of cytochromes P450 2C9 and 3A4 as the major catalysts of phenprocoumon hydroxylation in vitro. Eur J Clin Pharmacol. 2004 May;60(3):173-82.
• [375] FDA Label of Qsymia. The 2020 official website of the U.S. Food and Drug Administration.
• [376] Coadministration of lopinavir/ritonavir and phenytoin results in two-way drug interaction through cytochrome P-450 induction. J Acquir Immune Defic Syndr. 2004 Aug 15;36(5):1034-40.
• [377] The inhibition of CYP enzymes in mouse and human liver by pilocarpine. Br J Pharmacol. 1995 Feb;114(4):832-6.
• [378] Pimecrolimus: absorption, distribution, metabolism, and excretion in healthy volunteers after a single oral dose and supplementary investigations in vitro. Drug Metab Dispos. 2006 May;34(5):765-74.
• [379] Identification and characterization of human cytochrome P450 isoforms interacting with pimozide. J Pharmacol Exp Ther. 1998 May;285(2):428-37.
• [380] Cytochrome P450 3A4-mediated oxidative conversion of a cyano to an amide group in the metabolism of pinacidil. Biochemistry. 2002 Feb 26;41(8):2712-8.
• [381] Pioglitazone is metabolised by CYP2C8 and CYP3A4 in vitro: potential for interactions with CYP2C8 inhibitors. Basic Clin Pharmacol Toxicol. 2006 Jul;99(1):44-51.
• [382] Main contribution of the cytochrome P450 isoenzyme 1A2 (CYP1A2) to N-demethylation and 5-sulfoxidation of the phenothiazine neuroleptic chlorpromazine in human liver--A comparison with other phenothiazines. Biochem Pharmacol. 2010 Oct 15;80(8):1252-9.
• [383] Characterization of in vitro metabolites of deoxypodophyllotoxin in human and rat liver microsomes using liquid chromatography/tandem mass spectrometry. Rapid Commun Mass Spectrom. 2008;22(1):52-8.
• [384] FDA label of Polatuzumab vedotin-piiq. The 2020 official website of the U.S. Food and Drug Administration.
• [385] Pomalidomide: evaluation of cytochrome P450 and transporter-mediated drug-drug interaction potential in vitro and in healthy subjects. J Clin Pharmacol. 2015 Feb;55(2):168-78.
• [386] Evaluation of the effect of multiple doses of rifampin on the pharmacokinetics and safety of ponatinib in healthy subjects. Clin Pharmacol Drug Dev. 2015 Sep;4(5):354-60.
• [387] Survey of computed tomography doses and establishment of national diagnostic reference levels in the Republic of Belarus. Radiat Prot Dosimetry. 2010 Apr-May;139(1-3):367-70.
• [388] Effect of clarithromycin on the pharmacokinetics of pranlukast in healthy volunteers. Drug Metab Pharmacokinet. 2008;23(6):428-33.
• [389] Contribution of human hepatic cytochrome P450 isoforms to regioselective hydroxylation of steroid hormones. Xenobiotica. 1998 Jun;28(6):539-47.
• [390] The evolution of antiplatelet therapy in the treatment of acute coronary syndromes: from aspirin to the present day. Drugs. 2012 Nov 12;72(16):2087-116.
• [391] Clinical pharmacokinetics of pravastatin: mechanisms of pharmacokinetic events. Clin Pharmacokinet. 2000 Dec;39(6):397-412.
• [392] Metabolic profile of oxazepam and related benzodiazepines: clinical and forensic aspects. Drug Metab Rev. 2017 Nov;49(4):451-463.
• [393] Biotransformation of praziquantel by human cytochrome p450 3A4 (CYP 3A4). Acta Pol Pharm. 2006 Sep-Oct;63(5):381-5.
• [394] HEP Drug interaction: daclatasvir and abacavir.
• [395] Inter-individual difference determinant of prednisolone pharmacokinetics for Japanese renal transplant recipients in the maintenance stage. Xenobiotica. 2009 Dec;39(12):939-45.
• [396] FDA briefing document - pretomanid tablet, 200 mg meeting of the antimicrobial drugs advisory committee (AMDAC).
• [397] Primaquine metabolism by human liver microsomes: effect of other antimalarial drugs. Biochem Pharmacol. 1992 Aug 4;44(3):587-90.
• [398] In vitro proguanil activation to cycloguanil is mediated by CYP2C19 and CYP3A4 in adult Chinese liver microsomes. Acta Pharmacol Sin. 2000 Aug;21(8):747-52.
• [399] Contribution of human cytochrome p-450 isoforms to the metabolism of the simplest phenothiazine neuroleptic promazine. Br J Pharmacol. 2003 Apr;138(8):1465-74.
• [400] Effect of selective serotonin reuptake inhibitors on the oxidative metabolism of propafenone: in vitro studies using human liver microsomes. J Clin Psychopharmacol. 2000 Aug;20(4):428-34.
• [401] Product monograph: Mictoryl (Propiverine hydrochloride modified-release capsules).
• [402] Cytochrome P-450 2B6 is responsible for interindividual variability of propofol hydroxylation by human liver microsomes. Anesthesiology. 2001 Jan;94(1):110-9.
• [403] The metabolism of pyrazoloacridine (NSC 366140) by cytochromes p450 and flavin monooxygenase in human liver microsomes. Clin Cancer Res. 2004 Feb 15;10(4):1471-80.
• [404] Interaction between grapefruit juice and hypnotic drugs: comparison of triazolam and quazepam. Eur J Clin Pharmacol. 2006 Mar;62(3):209-15.
• [405] Metabolism of the active metabolite of quetiapine, N-desalkylquetiapine in vitro. Drug Metab Dispos. 2012 Sep;40(9):1778-84.
• [406] 10th North American ISSX meeting. October 24-28, 2000. Indianapolis, Indiana, USA. Abstracts. Drug Metab Rev. 2000;32 Suppl 2:137-340.
• [407] Quinine induced simvastatin toxicity through cytochrome inhibition - a case report. BMC Geriatr. 2016 Oct 1;16(1):168.
• [408] Effects of clarithromycin and verapamil on rabeprazole pharmacokinetics between CYP2C19 genotypes. Eur J Clin Pharmacol. 2006 Aug;62(8):597-603.
• [409] The role of P-glycoprotein in the bioactivation of raloxifene. Drug Metab Dispos. 2006 Dec;34(12):2073-8.
• [410] Metabolism of ramelteon in human liver microsomes and correlation with the effect of fluvoxamine on ramelteon pharmacokinetics. Drug Metab Dispos. 2010 Aug;38(8):1381-91.
• [411] Ranolazine: a contemporary review. J Am Heart Assoc. 2016 Mar 15;5(3):e003196.
• [412] Clinical pharmacokinetics of reboxetine, a selective norepinephrine reuptake inhibitor for the treatment of patients with depression. Clin Pharmacokinet. 2000 Dec;39(6):413-27.
• [413] FDA Label of Regorafenib. The 2020 official website of the U.S. Food and Drug Administration.
• [414] P-glycoprotein limits ribociclib brain exposure and CYP3A4 restricts its oral bioavailability. Mol Pharm. 2019 Sep 3;16(9):3842-3852.
• [415] The effect of multiple doses of ritonavir on the pharmacokinetics of rifabutin. Clin Pharmacol Ther. 1998 Apr;63(4):414-21.
• [416] Ketoconazole and rifampin significantly affect the pharmacokinetics, but not the safety or QTc interval, of casopitant, a neurokinin-1 receptor antagonist. J Clin Pharmacol. 2010 Aug;50(8):951-9.
• [417] Inhibitory potential of twenty five anti-tuberculosis drugs on CYP activities in human liver microsomes. Biol Pharm Bull. 2015;38(9):1425-9.
• [418] Probable interaction between warfarin and rifaximin in a patient treated for small intestine bacterial overgrowth. Ann Pharmacother. 2011 May;45(5):e25.
• [419] Potential of the novel antiretroviral drug rilpivirine to modulate the expression and function of drug transporters and drug-metabolising enzymes in vitro. Int J Antimicrob Agents. 2013 May;41(5):484-7.
• [420] Identification of clinically used drugs that activate pregnane X receptors. Drug Metab Dispos. 2011 Jan;39(1):151-9.
• [421] Riociguat (adempas): a novel agent for the treatment of pulmonary arterial hypertension and chronic thromboembolic pulmonary hypertension. P T. 2014 Nov;39(11):749-58.
• [422] A phase 1 healthy male volunteer single escalating dose study of the pharmacokinetics and pharmacodynamics of risdiplam (RG7916, RO7034067), a SMN2 splicing modifier. Br J Clin Pharmacol. 2019 Jan;85(1):181-193.
• [423] Effect of extended exposure to grapefruit juice on cytochrome P450 3A activity in humans: comparison with ritonavir. Clin Pharmacol Ther. 2006 Mar;79(3):243-54.
• [424] Comparative efficacy and safety of the novel oral anticoagulants dabigatran, rivaroxaban and apixaban in preclinical and clinical development. Thromb Haemost. 2010 Mar;103(3):572-85.
• [425] Effect of steady-state enoxacin on single-dose pharmacokinetics of roflumilast and roflumilast N-oxide. J Clin Pharmacol. 2011 Apr;51(4):586-93.
• [426] An in vitro study on the metabolism and possible drug interactions of rokitamycin, a macrolide antibiotic, using human liver microsomes. Drug Metab Dispos. 1999 Jul;27(7):776-85.
• [427] Pharmacokinetic interactions of rolapitant with cytochrome P450 3A substrates in healthy subjects. J Clin Pharmacol. 2019 Apr;59(4):488-499.
• [428] A phase I/II trial of the histone deacetylase inhibitor romidepsin for adults with recurrent malignant glioma: North American Brain Tumor Consortium Study 03-03. Neuro Oncol. 2011 May;13(5):509-16.
• [429] In vitro identification of the P450 enzymes responsible for the metabolism of ropinirole. Drug Metab Dispos. 1997 Jul;25(7):840-4.
• [430] Metabolism of a new local anesthetic, ropivacaine, by human hepatic cytochrome P450. Anesthesiology. 1995 Jan;82(1):214-20.
• [431] Effects of gemfibrozil, itraconazole, and their combination on the pharmacokinetics of pioglitazone. Clin Pharmacol Ther. 2005 May;77(5):404-14.
• [432] Effects of acid and lactone forms of eight HMG-CoA reductase inhibitors on CYP-mediated metabolism and MDR1-mediated transport. Pharm Res. 2006 Mar;23(3):506-12.
• [433] Disposition and metabolism of safinamide, a novel drug for Parkinson's disease, in healthy male volunteers. Pharmacology. 2013;92(3-4):207-16.
• [434] Clinical pharmacokinetics of salmeterol. Clin Pharmacokinet. 2002;41(1):19-30.
• [435] Effect of saquinavir-ritonavir on cytochrome P450 3A4 activity in healthy volunteers using midazolam as a probe. Pharmacotherapy. 2009 Oct;29(10):1175-81.
• [436] Effect of rifampicin on the pharmacokinetics and pharmacodynamics of saxagliptin, a dipeptidyl peptidase-4 inhibitor, in healthy subjects. Br J Clin Pharmacol. 2011 Jul;72(1):92-102.
• [437] P450 phenotyping of the metabolism of selegiline to desmethylselegiline and methamphetamine. Drug Metab Pharmacokinet. 2007 Apr;22(2):78-87.
• [438] Sibutramine: a serotonin-norepinephrine reuptake-inhibitor for the treatment of obesity. Ann Pharmacother. 1999 Sep;33(9):968-78.
• [439] Silodosin for benign prostatic hyperplasia. Ann Pharmacother. 2010 Feb;44(2):302-10.
• [440] Hepatitis C virus direct-acting antiviral drug interactions and use in renal and hepatic impairment. Top Antivir Med. 2015 May-Jun;23(2):92-6.
• [441] A comparison of the effects of 3-hydroxy-3-methylglutaryl-coenzyme a (HMG-CoA) reductase inhibitors on the CYP3A4-dependent oxidation of mexazolam in vitro. Drug Metab Dispos. 2001 Mar;29(3):282-8.
• [442] Metabolism and disposition of siponimod, a novel selective S1P1/S1P5 agonist, in healthy volunteers and in vitro identification of human cytochrome P450 enzymes involved in its oxidative metabolism. Drug Metab Dispos. 2018 Jul;46(7):1001-1013.
• [443] Pharmacokinetics of dipeptidylpeptidase-4 inhibitors. Diabetes Obes Metab. 2010 Aug;12(8):648-58.
• [444] Clinical pharmacokinetics and pharmacodynamics of solifenacin. Clin Pharmacokinet. 2009;48(5):281-302.
• [445] Sonidegib: first global approval. Drugs. 2015 Sep;75(13):1559-66.
• [446] Interaction of sorafenib and cytochrome P450 isoenzymes in patients with advanced melanoma: a phase I/II pharmacokinetic interaction study. Cancer Chemother Pharmacol. 2011 Nov;68(5):1111-8.
• [447] Product characteristics of Diacomit.
• [448] Possible involvement of multiple cytochrome P450S in fentanyl and sufentanil metabolism as opposed to alfentanil. Biochem Pharmacol. 1997 Jun 1;53(11):1613-9.
• [449] The effect of cimetidine on the formation of sulfamethoxazole hydroxylamine in patients with human immunodeficiency virus. J Clin Pharmacol. 1998 May;38(5):463-6.
• [450] CYP3A4 induction by drugs: correlation between a pregnane X receptor reporter gene assay and CYP3A4 expression in human hepatocytes. Drug Metab Dispos. 2002 Jul;30(7):795-804.
• [451] Suvorexant: a promising, novel treatment for insomnia. Neuropsychiatr Dis Treat. 2016 Feb 25;12:491-5.
• [452] Contribution of CYP3A isoforms to dealkylation of PDE5 inhibitors: a comparison between sildenafil N-demethylation and tadalafil demethylenation. Biol Pharm Bull. 2015;38(1):58-65.
• [453] Comprehensive evaluation of tamoxifen sequential biotransformation by the human cytochrome P450 system in vitro: prominent roles for CYP3A and CYP2D6. J Pharmacol Exp Ther. 2004 Sep;310(3):1062-75.
• [454] Identification of cytochrome P450 isozymes involved in metabolism of the alpha1-adrenoceptor blocker tamsulosin in human liver microsomes. Xenobiotica. 1998 Oct;28(10):909-22.
• [455] Clinical assessment of drug-drug interactions of tasimelteon, a novel dual melatonin receptor agonist. J Clin Pharmacol. 2015 Sep;55(9):1004-11.
• [456] Managing drug-drug interactions with boceprevir and telaprevir. Clin Liver Dis (Hoboken). 2012 Apr 26;1(2):36-40.
• [457] Drug interactions during therapy with three major groups of antimicrobial agents. Expert Opin Pharmacother. 2006 Apr;7(6):639-51.
• [458] Human liver microsomal diazepam metabolism using cDNA-expressed cytochrome P450s: role of CYP2B6, 2C19 and the 3A subfamily. Xenobiotica. 1996 Nov;26(11):1155-66.
• [459] FDA label of Tenapanor. The 2020 official website of the U.S. Food and Drug Administration.
• [460] Screening for inhibitory effects of antineoplastic agents on CYP3A4 in human liver microsomes. Int J Clin Pharmacol Ther. 2001 Dec;39(12):517-28.
• [461] FDA label of Bictegravir, emtricitabine, and tenofovir alafenamide. The 2020 official website of the U.S. Food and Drug Administration.
• [462] Digging deeper into CYP3A testosterone metabolism: kinetic, regioselectivity, and stereoselectivity differences between CYP3A4/5 and CYP3A7. Drug Metab Dispos. 2017 Dec;45(12):1266-1275.
• [463] Characterization of human cytochromes P450 involved in theophylline 8-hydroxylation. Biochem Pharmacol. 1995 Jul 17;50(2):205-11.
• [464] Protein binding and the metabolism of thiamylal enantiomers in vitro. Anesth Analg. 2000 Sep;91(3):736-40.
• [465] Cytochrome P450 isozymes 3A4 and 2B6 are involved in the in vitro human metabolism of thiotepa to TEPA. Cancer Chemother Pharmacol. 2002 Jun;49(6):461-7.
• [466] Enzyme induction and inhibition by new antiepileptic drugs: a review of human studies. Fundam Clin Pharmacol. 2000 Jul-Aug;14(4):301-19.
• [467] Tianeptine: a facilitator of the reuptake of serotonin and norepinephrine as an antidepressant? J Psychiatr Pract. 2004 Sep;10(5):323-30.
• [468] FDA label of Tinidazole. The 2020 official website of the U.S. Food and Drug Administration.
• [469] A phenotype-genotype approach to predicting CYP450 and P-glycoprotein drug interactions with the mixed inhibitor/inducer tipranavir/ritonavir. Clin Pharmacol Ther. 2010 Jun;87(6):735-42.
• [470] The pharmacokinetics, metabolism, and clearance mechanisms of tofacitinib, a janus kinase inhibitor, in humans. Drug Metab Dispos. 2014 Apr;42(4):759-73.
• [471] Tolterodine, a new muscarinic receptor antagonist, is metabolized by cytochromes P450 2D6 and 3A in human liver microsomes. Drug Metab Dispos. 1998 Apr;26(4):289-93.
• [472] Tolvaptan: a new therapeutic agent. Rev Recent Clin Trials. 2011 May;6(2):177-88.
• [473] Dose-dependent induction of cytochrome P450 (CYP) 3A4 and activation of pregnane X receptor by topiramate. Epilepsia. 2003 Dec;44(12):1521-8.
• [474] Drug interaction potential of toremifene and N-desmethyltoremifene with multiple cytochrome P450 isoforms. Xenobiotica. 2011 Oct;41(10):851-62.
• [475] Mass balance and drug interaction potential of intravenous eravacycline administered to healthy subjects. Antimicrob Agents Chemother. 2019 Feb 26;63(3). pii: e01810-18.
• [476] In vitro characterization of the human biotransformation and CYP reaction phenotype of ET-743 (Yondelis, Trabectidin), a novel marine anti-cancer drug. Invest New Drugs. 2006 Jan;24(1):3-14.
• [477] Clinical pharmacology of tramadol. Clin Pharmacokinet. 2004;43(13):879-923.
• [478] Metabolic activation of the nontricyclic antidepressant trazodone to electrophilic quinone-imine and epoxide intermediates in human liver microsomes and recombinant P4503A4. Chem Biol Interact. 2005 Jun 30;155(1-2):10-20.
• [479] Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites. Mol Pharmacol. 2000 Dec;58(6):1341-8.
• [480] Triamcinolone acetonide induced secondary adrenal insufficiency related to impaired CYP3A4 metabolism by coadministration of nefazodone. Pain Med. 2010 Jul;11(7):1132-5.
• [481] In vitro metabolism of midazolam, triazolam, nifedipine, and testosterone by human liver microsomes and recombinant cytochromes p450: role of cyp3a4 and cyp3a5. Drug Metab Dispos. 2003 Jul;31(7):938-44.
• [482] In vitro drug-drug interaction potential of sulfoxide and/or sulfone metabolites of albendazole, triclabendazole, aldicarb, methiocarb, montelukast and ziprasidone. Drug Metab Lett. 2018;12(2):101-116.
• [483] FDA label of Trifarotene. The 2020 official website of the U.S. Food and Drug Administration.
• [484] Long-term low-dose ketoconazole treatment in bilateral macronodular adrenal hyperplasia. Endocrinol Diabetes Metab Case Rep. 2014;2014:140083.
• [485] Investigation of the major human hepatic cytochrome P450 involved in 4-hydroxylation and N-dechloroethylation of trofosfamide. Cancer Chemother Pharmacol. 1999;44(4):327-34.
• [486] Effect of genetic polymorphisms in cytochrome p450 (CYP) 2C9 and CYP2C8 on the pharmacokinetics of oral antidiabetic drugs: clinical relevance. Clin Pharmacokinet. 2005;44(12):1209-25.
• [487] Effects of roxithromycin, erythromycin and troleandomycin on their N-demethylation by rat and human cytochrome P450 enzymes. Xenobiotica. 1996 Nov;26(11):1143-53.
• [488] The contributions of cytochromes P450 3A4 and 3A5 to the metabolism of the phosphodiesterase type 5 inhibitors sildenafil, udenafil, and vardenafil. Drug Metab Dispos. 2008 Jun;36(6):986-90.
• [489] Emergency contraception. Gynecol Endocrinol. 2013 Mar;29 Suppl 1:1-14.
• [490] Population pharmacokinetics of upadacitinib using the immediate-release and extended-release formulations in healthy subjects and subjects with rheumatoid arthritis: analyses of phase I-III clinical trials. Clin Pharmacokinet. 2019 Aug;58(8):1045-1058.
• [491] Simultaneous assessment of drug interactions with low- and high-extraction opioids: application to parecoxib effects on the pharmacokinetics and pharmacodynamics of fentanyl and alfentanil. Anesthesiology. 2003 Apr;98(4):853-61.
• [492] FDA label of Vandetanib. The 2020 official website of the U.S. Food and Drug Administration.
• [493] Erectile dysfunction drugs changed the protein expressions and activities of drug-metabolising enzymes in the liver of male rats. Oxid Med Cell Longev. 2016;2016:4970906.
• [494] Product characteristics of Epclusa.
• [495] Vemurafenib for the treatment of melanoma. Expert Opin Pharmacother. 2012 Dec;13(17):2533-43.
• [496] The effect of ketoconazole on the pharmacokinetics and pharmacodynamics of inhaled fluticasone furoate and vilanterol trifenatate in healthy subjects. Br J Clin Pharmacol. 2013 Jun;75(6):1478-87.
• [497] Vilazodone HCl (Viibryd): A Serotonin Partial Agonist and Reuptake Inhibitor For the Treatment of Major Depressive Disorder. P T. 2012 Jan;37(1):28-31.
• [498] Induction of CYP3A4 by vinblastine: role of the nuclear receptor NR1I2. Ann Pharmacother. 2010 Nov;44(11):1709-17.
• [499] Characterization of human cytochrome P450 isoenzymes involved in the metabolism of vinorelbine. Fundam Clin Pharmacol. 2005 Oct;19(5):545-53.
• [500] Association of CYP3A5 expression and vincristine neurotoxicity in pediatric malignancies in Turkish population. J Pediatr Hematol Oncol. 2017 Aug;39(6):458-462.
• [501] Human liver microsomal cytochrome P450 3A isozymes mediated vindesine biotransformation. Metabolic drug interactions. Biochem Pharmacol. 1993 Feb 24;45(4):853-61.
• [502] The dawn of hedgehog inhibitors: Vismodegib. J Pharmacol Pharmacother. 2013 Jan;4(1):4-7.
• [503] Biosynthesis of all-trans-retinoic acid from all-trans-retinol: catalysis of all-trans-retinol oxidation by human P-450 cytochromes. Drug Metab Dispos. 2000 Mar;28(3):315-22.
• [504] Interplay between vitamin D and the drug metabolizing enzyme CYP3A4. J Steroid Biochem Mol Biol. 2013 Jul;136:54-8.
• [505] Adverse effects of vitamin E by induction of drug metabolism. Genes Nutr. 2007 Dec;2(3):249-56.
• [506] Vorapaxar: the missing link in antiplatelet therapy! J Anaesthesiol Clin Pharmacol. 2017 Apr-Jun;33(2):269-270.
• [507] Roles of CYP3A4 and CYP2C19 in methyl hydroxylated and N-oxidized metabolite formation from voriconazole, a new anti-fungal agent, in human liver microsomes. Biochem Pharmacol. 2007 Jun 15;73(12):2020-6.
• [508] Identification of the cytochrome P450 and other enzymes involved in the in vitro oxidative metabolism of a novel antidepressant, Lu AA21004. Drug Metab Dispos. 2012 Jul;40(7):1357-65.
• [509] Contribution of three CYP3A isoforms to metabolism of R- and S-warfarin. Drug Metab Lett. 2010 Dec;4(4):213-9.
• [510] Extended-release alfuzosin hydrochloride: a new alpha-adrenergic receptor antagonist for symptomatic benign prostatic hyperplasia. Am J Geriatr Pharmacother. 2004 Mar;2(1):14-23.
• [511] Human sympathetic activation by alpha2-adrenergic blockade with yohimbine: bimodal, epistatic influence of cytochrome P450-mediated drug metabolism. Clin Pharmacol Ther. 2004 Aug;76(2):139-53.
• [512] Fluconazole but not the CYP3A4 inhibitor, itraconazole, increases zafirlukast plasma concentrations. Eur J Clin Pharmacol. 2012 May;68(5):681-8.
• [513] Protease inhibitors in patients with HIV disease. Clinically important pharmacokinetic considerations. Clin Pharmacokinet. 1997 Mar;32(3):194-209.
• [514] Metabolism of zaleplon by human liver: evidence for involvement of aldehyde oxidase. Xenobiotica. 2002 Oct;32(10):835-47.
• [515] FDA label of Zanubrutinib. The 2020 official website of the U.S. Food and Drug Administration.
• [516] The metabolism of zidovudine by human liver microsomes in vitro: formation of 3'-amino-3'-deoxythymidine. Biochem Pharmacol. 1994 Jul 19;48(2):267-76.
• [517] Metabolism of atypical antipsychotics: involvement of cytochrome p450 enzymes and relevance for drug-drug interactions. Curr Drug Metab. 2008 Jun;9(5):410-8.
• [518] Zolpidem pharmacokinetics and pharmacodynamics in metabolic interactions involving CYP3A: sex as a differentiating factor. Eur J Clin Pharmacol. 2010 Sep;66(9):955.
• [519] Pharmacokinetics and drug interactions with zonisamide. Epilepsia. 2007 Mar;48(3):435-41.
• [520] Eszopiclone, a nonbenzodiazepine sedative-hypnotic agent for the treatment of transient and chronic insomnia. Clin Ther. 2006 Apr;28(4):491-516.
• [521] New antipsychotic agents for schizophrenia: pharmacokinetics and metabolism update. Curr Opin Investig Drugs. 2002 Jul;3(7):1073-80.
• [522] Metabolic pathway of icotinib in vitro: the differential roles of CYP3A4, CYP3A5, and CYP1A2 on potential pharmacokinetic drug-drug interaction. J Pharm Sci. 2018 Apr;107(4):979-983.
• [523] Contribution of human hepatic cytochrome P450s and steroidogenic CYP17 to the N-demethylation of aminopyrine. Xenobiotica. 1999 Feb;29(2):187-93.
• [524] KEGG: new perspectives on genomes, pathways, diseases and drugs. Nucleic Acids Res. 2017 Jan 4;45(D1):D353-D361. (DRUG:D01145)
• [525] Examination of metabolic pathways and identification of human liver cytochrome P450 isozymes responsible for the metabolism of barnidipine, a calcium channel blocker. Xenobiotica. 1997 Sep;27(9):885-900.
• [526] Application of static models to predict midazolam clinical interactions in the presence of single or multiple hepatitis C virus drugs. Drug Metab Dispos. 2016 Aug;44(8):1372-80.
• [527] Characterization of benidipine and its enantiomers' metabolism by human liver cytochrome P450 enzymes. Drug Metab Dispos. 2007 Sep;35(9):1518-24.
• [528] Inhibition of the metabolism of brotizolam by erythromycin in humans: in vivo evidence for the involvement of CYP3A4 in brotizolam metabolism. Br J Clin Pharmacol. 2005 Aug;60(2):172-5.
• [529] Stereoselective metabolism of cibenzoline, an antiarrhythmic drug, by human and rat liver microsomes: possible involvement of CYP2D and CYP3A. Drug Metab Dispos. 2000 Sep;28(9):1128-34.
• [530] Pharmacokinetics of single and multiple escalating doses of dapoxetine in healthy volunteers. Clinical Pharmacology Therapeutics, 2004, 75(2):P32.
• [531] Drug interactions between rifamycin antibiotics and hormonal contraception: a systematic review. BJOG. 2018 Jun;125(7):804-811.
• [532] Pharmacokinetics of dihydrocodeine and its active metabolite after single and multiple oral dosing. Br J Clin Pharmacol. 1999 Sep;48(3):317-22.
• [533] Characterization of ebastine, hydroxyebastine, and carebastine metabolism by human liver microsomes and expressed cytochrome P450 enzymes: major roles for CYP2J2 and CYP3A. Drug Metab Dispos. 2006 Nov;34(11):1793-7.
• [534] The involvement of CYP3A4 and CYP2C9 in the metabolism of 17 alpha-ethinylestradiol. Drug Metab Dispos. 2004 Nov;32(11):1209-12.
• [535] Inhibition of the metabolism of etizolam by itraconazole in humans: evidence for the involvement of CYP3A4 in etizolam metabolism. Eur J Clin Pharmacol. 2004 Aug;60(6):427-30.
• [536] In vitro identification of metabolic pathways and cytochrome P450 enzymes involved in the metabolism of etoperidone. Xenobiotica. 2002 Nov;32(11):949-62.
• [537] Effect of an oral contraceptive preparation containing ethinylestradiol and gestodene on CYP3A4 activity as measured by midazolam 1'-hydroxylation. Br J Clin Pharmacol. 2000 Oct;50(4):333-7.
• [538] FDA label of Elbasvir and grazoprevir. The 2020 official website of the U.S. Food and Drug Administration.
• [539] The effects of lacidipine on the steady/state plasma concentrations of simvastatin in healthy subjects. Br J Clin Pharmacol. 2001 Feb;51(2):147-52.
• [540] The involvement of flavin-containing monooxygenase but not CYP3A4 in metabolism of itopride hydrochloride, a gastroprokinetic agent: comparison with cisapride and mosapride citrate. Drug Metab Dispos. 2000 Oct;28(10):1231-7.
• [541] Simultaneous determination of parecoxib and its main metabolites valdecoxib and hydroxylated valdecoxib in mouse plasma with a sensitive LC-MS/MS method to elucidate the decreased drug metabolism of tumor bearing mice. J Pharm Biomed Anal. 2018 Sep 5;158:1-7.
• [542] Cytochrome P450 expression and regulation in CYP3A4/CYP2D6 double transgenic humanized mice. Drug Metab Dispos. 2008 Feb;36(2):435-41.
• [543] Rupatadine: pharmacological profile and its use in the treatment of allergic disorders. Expert Opin Pharmacother. 2006 Oct;7(14):1989-2001.
• [544] In vitro metabolism of TAK-438, vonoprazan fumarate, a novel potassium-competitive acid blocker. Xenobiotica. 2017 Dec;47(12):1027-1034.
• [545] Metabolism of 5-methoxypsoralen by Saccharomyces cerevisiae. Photochem Photobiol. 1991 Nov;54(5):689-95.
• [546] Effect of rifampin on the pharmacokinetics, safety and tolerability of navitoclax (ABT-263), a dual inhibitor of Bcl-2 and Bcl-XL , in patients with cancer. J Clin Pharm Ther. 2014 Dec;39(6):680-4.
• [547] Identification of the human liver cytochrome P450 enzymes involved in the in vitro metabolism of a novel 5-lipoxygenase inhibitor. Drug Metab Dispos. 1998 Oct;26(10):970-6.
• [548] Anlotinib: a novel multi-targeting tyrosine kinase inhibitor in clinical development. J Hematol Oncol. 2018 Sep 19;11(1):120.
• [549] Profile of alisporivir and its potential in the treatment of hepatitis C. Drug Des Devel Ther. 2013;7:105-15.
• [550] Metabolism and excretion of anacetrapib, a novel inhibitor of the cholesteryl ester transfer protein, in humans. Drug Metab Dispos. 2010 Mar;38(3):474-83.
• [551] Effect of nilvadipine, a dihydropyridine calcium antagonist, on cytochrome P450 activities in human hepatic microsomes. Biol Pharm Bull. 2004 Mar;27(3):415-7.
• [552] Amenamevir: studies of potential CYP3A-mediated pharmacokinetic interactions with midazolam, cyclosporine, and ritonavir in healthy volunteers. Clin Pharmacol Drug Dev. 2018 Nov;7(8):844-859.
• [553] Organic anion transporting polypeptide 1B1 activity classified by SLCO1B1 genotype influences atrasentan pharmacokinetics. Clin Pharmacol Ther. 2006 Mar;79(3):186-96.
• [554] The metabolic profile of azimilide in man: in vivo and in vitro evaluations. J Pharm Sci. 2005 Sep;94(9):2084-95.
• [555] Multicenter phase I trial of the mitogen-activated protein kinase 1/2 inhibitor BAY 86-9766 in patients with advanced cancer. Clin Cancer Res. 2013 Mar 1;19(5):1232-43.
• [556] Profile of blonanserin for the treatment of schizophrenia. Neuropsychiatr Dis Treat. 2013;9:587-94.
• [557] In vitro hepatic metabolism of cediranib, a potent vascular endothelial growth factor tyrosine kinase inhibitor: interspecies comparison and human enzymology. Drug Metab Dispos. 2010 Oct;38(10):1688-97.
• [558] Metabolism of benzalkonium chlorides by human hepatic cytochromes P450. Chem Res Toxicol. 2019 Dec 16;32(12):2466-2478.
• [559] Metabolism and metabolic inhibition of cilnidipine in human liver microsomes. Acta Pharmacol Sin. 2003 Mar;24(3):263-8.
• [560] The prokinetic cinitapride has no clinically relevant pharmacokinetic interaction and effect on QT during coadministration with ketoconazole. Drug Metab Dispos. 2007 Jul;35(7):1149-56.
• [561] In vitro and in vivo assessment of the effect of dalcetrapib on a panel of CYP substrates. Curr Med Res Opin. 2009 Apr;25(4):891-902.
• [562] FDA label of Sacubitril and valsartan. The 2020 official website of the U.S. Food and Drug Administration.
• [563] Phase I study of enzastaurin and bevacizumab in patients with advanced cancer: safety, efficacy and pharmacokinetics. Invest New Drugs. 2013 Jun;31(3):653-60.
• [564] Characterization of human cytochrome P450 enzymes involved in the biotransformation of eperisone. Xenobiotica. 2009 Jan;39(1):1-10.
• [565] Identification of cytochrome P450 enzymes involved in the metabolism of 4'-methoxy-alpha-pyrrolidinopropiophenone (MOPPP), a designer drug, in human liver microsomes. Xenobiotica. 2003 Oct;33(10):989-98.
• [566] Phase I and pharmacological study of a new camptothecin derivative, exatecan mesylate (DX-8951f), infused over 30 minutes every three weeks. Clin Cancer Res. 2001 Oct;7(10):3056-64.
• [567] Effect of glycyrrhizin on the activity of CYP3A enzyme in humans. Eur J Clin Pharmacol. 2010 Aug;66(8):805-810.
• [568] Product Information of Eumovate.
• [569] Studies of the pharmacology of 17alpha-ethynyl-androst-5-ene-3beta,7beta,17beta-triol, a synthetic anti-inflammatory androstene. Int J Clin Exp Med. 2011;4(2):119-35.
• [570] Pharmacodynamics, pharmacokinetics and clinical efficacy of neratinib in HER2-positive breast cancer and breast cancer with HER2 mutations. Expert Opin Drug Metab Toxicol. 2016 Aug;12(8):947-57.
• [571] An updated review of iclaprim: a potent and rapidly bactericidal antibiotic for the treatment of skin and skin structure infections and nosocomial pneumonia caused by gram-positive including multidrug-resistant bacteria. Open Forum Infect Dis. 2018 Jan 6;5(2):ofy003.
• [572] Pharmacokinetic evaluation of CYP3A4-mediated drug-drug interactions of isavuconazole with rifampin, ketoconazole, midazolam, and ethinyl estradiol/norethindrone in healthy adults. Clin Pharmacol Drug Dev. 2017 Jan;6(1):44-53.
• [573] Ruxolitinib: in the treatment of myelofibrosis. Drugs. 2012 Nov 12;72(16):2117-27.
• [574] Evaluation of in vitro drug interactions with karenitecin, a novel, highly lipophilic camptothecin derivative in phase II clinical development. J Clin Pharmacol. 2003 Sep;43(9):1008-14.
• [575] Oral laquinimod treatment in multiple sclerosis. Neurologia. 2011 Mar;26(2):111-7.
• [576] Induction of cytochromes P-450 2B and 3A in mice following the dietary administration of the novel cognitive enhancer linopirdine. Drug Metab Dispos. 1994 Jan-Feb;22(1):65-73.
• [577] Idalopirdine as a treatment for Alzheimer's disease. Expert Opin Investig Drugs. 2015;24(7):981-7.
• [578] Effect of grapefruit juice on the disposition of manidipine enantiomers in healthy subjects. Br J Clin Pharmacol. 2006 May;61(5):533-7.
• [579] Maribavir pharmacokinetics and the effects of multiple-dose maribavir on cytochrome P450 (CYP) 1A2, CYP 2C9, CYP 2C19, CYP 2D6, CYP 3A, N-acetyltransferase-2, and xanthine oxidase activities in healthy adults. Antimicrob Agents Chemother. 2006 Apr;50(4):1130-5.
• [580] Pharmacokinetics and disposition of momelotinib revealed a disproportionate human metabolite-resolution for clinical development. Drug Metab Dispos. 2018 Mar;46(3):237-247.
• [581] Involvement of multiple cytochrome P450 and UDP-glucuronosyltransferase enzymes in the in vitro metabolism of muraglitazar. Drug Metab Dispos. 2007 Jan;35(1):139-49.
• [582] Pharmacokinetic evaluation of nabiximols for the treatment of multiple sclerosis pain. Expert Opin Drug Metab Toxicol. 2013 Sep;9(9):1219-28.
• [583] Complementary pharmacokinetic profiles of netupitant and palonosetron support the rationale for their oral fixed combination for the prevention of chemotherapy-induced nausea and vomiting. J Clin Pharmacol. 2019 Apr;59(4):472-487.
• [584] Disposition and metabolism of the cathepsin K inhibitor odanacatib in humans. Drug Metab Dispos. 2014 May;42(5):818-27.
• [585] Tiotropium bromide. A review of its use as maintenance therapy in patients with COPD. Treat Respir Med. 2004;3(4):247-68.
• [586] In vitro characterization of the human biotransformation pathways of aplidine, a novel marine anti-cancer drug. Invest New Drugs. 2007 Feb;25(1):9-19.
• [587] Preclinical metabolism and disposition of SB939 (Pracinostat), an orally active histone deacetylase inhibitor, and prediction of human pharmacokinetics. Drug Metab Dispos. 2011 Dec;39(12):2219-32.
• [588] Involvement of cytochrome P450 in the metabolism of rebamipide by the human liver. Xenobiotica. 2002 Jul;32(7):573-86.
• [589] Influence of cytochrome P450 induction on the pharmacokinetics and pharmacodynamics of remacemide hydrochloride. Epilepsy Res. 2002 May;49(3):247-54.
• [590] Identification of enzymes responsible for rifalazil metabolism in human liver microsomes. Xenobiotica. 2000 Jun;30(6):565-74.
• [591] Simultaneous pharmacokinetic model for rolofylline and both M1-trans and M1-cis metabolites. AAPS J. 2013 Apr;15(2):498-504.
• [592] FDA label of Selinexor. The 2020 official website of the U.S. Food and Drug Administration.
• [593] Disposition and metabolism of semagacestat, a {gamma}-secretase inhibitor, in humans. Drug Metab Dispos. 2010 Apr;38(4):554-65.
• [594] Disposition and metabolism of the G protein-coupled receptor 40 agonist TAK-875 (fasiglifam) in rats, dogs, and humans. Xenobiotica. 2019 Apr;49(4):433-445.
• [595] Preclinical pharmacokinetics of triptolide: a potential antitumor drug. Curr Drug Metab. 2019;20(2):147-154.
• [596] Fexinidazole--a new oral nitroimidazole drug candidate entering clinical development for the treatment of sleeping sickness. PLoS Negl Trop Dis. 2010 Dec 21;4(12):e923.
• [597] In vitro characterization of sarizotan metabolism: hepatic clearance, identification and characterization of metabolites, drug-metabolizing enzyme identification, and evaluation of cytochrome p450 inhibition. Drug Metab Dispos. 2010 Jun;38(6):905-16.
• [598] Guidelines for the treatment of hypothyroidism: prepared by the american thyroid association task force on thyroid hormone replacement. Thyroid. 2014 Dec;24(12):1670-751.
• [599] Cytochrome P450 3A-mediated metabolism of the topoisomerase I inhibitor 9-aminocamptothecin: impact on cancer therapy. Int J Oncol. 2014 Aug;45(2):877-86.
• [600] Effect of ketoconazole on the pharmacokinetics of the 11beta-hydroxysteroid dehydrogenase type 1 inhibitor ABT-384 and its two active metabolites in healthy volunteers: population analysis of data from a drug-drug interaction study. Drug Metab Dispos. 2013 May;41(5):1035-45.
• [601] First-in-human pharmacokinetic and pharmacodynamic study of the dual m-TORC 1/2 inhibitor AZD2014. Clin Cancer Res. 2015 Aug 1;21(15):3412-9.
• [602] BC-3781: Evaluation of the CYP3A Interaction Potential.
• [603] Frontiers in CNS Drug Discovery. Edited by Atta-ur Rahman, M. Iqbal Choudhary. Page: 318.
• [604] Characterization of ADME properties of [(14)C]asunaprevir (BMS-650032) in humans. Xenobiotica. 2016;46(1):52-64.
• [605] Metabolism of carfentanil, an ultra-potent opioid, in human liver microsomes and human hepatocytes by high-resolution mass spectrometry. AAPS J. 2016 Nov;18(6):1489-1499.
• [606] Pharmacokinetics, safety, and CCR2/CCR5 antagonist activity of cenicriviroc in participants with mild or moderate hepatic impairment. Clin Transl Sci. 2016 Jun;9(3):139-48.
• [607] In vitro metabolism of CP-122,721 ((2S,3S)-2-phenyl-3-[(5-trifluoromethoxy-2-methoxy)benzylamino]piperidine), a non-peptide antagonist of the substance P receptor. Drug Metab Pharmacokinet. 2007 Oct;22(5):336-49.
• [608] Comprehensive Medicinal Chemistry III. Page: 569.
• [609] Pharmacokinetic profile of dexloxiglumide. Clin Pharmacokinet. 2006;45(12):1177-88.
• [610] Safety assessment, in vitro and in vivo, and pharmacokinetics of emivirine, a potent and selective nonnucleoside reverse transcriptase inhibitor of human immunodeficiency virus type 1. Antimicrob Agents Chemother. 2000 Jan;44(1):123-30.
• [611] Metabolism and bioactivation of famitinib, a novel inhibitor of receptor tyrosine kinase, in cancer patients. Br J Pharmacol. 2013 Apr;168(7):1687-706.
• [612] In vitro metabolism of ferroquine (SSR97193) in animal and human hepatic models and antimalarial activity of major metabolites on Plasmodium falciparum. Drug Metab Dispos. 2006 Apr;34(4):667-82.
• [613] Identification of human cytochrome P-450 isoforms involved in metabolism of R(+)- and S(-)-gallopamil: utility of in vitro disappearance rate. Drug Metab Dispos. 1999 Nov;27(11):1254-9.
• [614] The oral toll-like receptor-7 agonist GS-9620 in patients with chronic hepatitis B virus infection. J Hepatol. 2015 Aug;63(2):320-8.
• [615] 17alpha-alkynyl 3alpha, 17beta-androstanediol non-clinical and clinical pharmacology, pharmacokinetics and metabolism. Invest New Drugs. 2012 Feb;30(1):59-78.
• [616] Cytochrome p450: a target for drug development for skin diseases. J Invest Dermatol. 2004 Sep;123(3):417-25.
• [617] CYP3A4 and 3A5 catalysed alprazolam metabolism in vitro and in vivo. International Clinical Psychopharmacology, 2006, 21(4):A33.
• [618] Metabolic characterization of a tripeptide human immunodeficiency virus type 1 protease inhibitor, KNI-272, in rat liver microsomes. Antimicrob Agents Chemother. 1999 Mar;43(3):549-56.
• [619] Excretion and metabolism of lersivirine (5-{[3,5-diethyl-1-(2-hydroxyethyl)(3,5-14C2)-1H-pyrazol-4-yl]oxy}benzene-1,3-dicarbonitrile), a next-generation non-nucleoside reverse transcriptase inhibitor, after administration of [14C]Lersivirine to healthy volunteers. Drug Metab Dispos. 2010 May;38(5):789-800.
• [620] Disposition and metabolism of LY2603618, a Chk-1 inhibitor following intravenous administration in patients with advanced and/or metastatic solid tumors. Xenobiotica. 2014 Sep;44(9):827-41.
• [621] The interactions of a selective protein kinase C beta inhibitor with the human cytochromes P450. Drug Metab Dispos. 2002 Sep;30(9):957-61.
• [622] Preclinical pharmacokinetics of a HepDirect prodrug of a novel phosphonate-containing thyroid hormone receptor agonist. Drug Metab Dispos. 2008 Nov;36(11):2393-403.
• [623] Metabolism of the MEK1/2 inhibitor pimasertib involves a novel conjugation with phosphoethanolamine in patients with solid tumors. Drug Metab Dispos. 2017 Feb;45(2):174-182.
• [624] Drug-metabolizing enzymes and transporters: expression in the human prostate and roles in prostate drug disposition. J Androl. 2006 Mar-Apr;27(2):138-50.
• [625] Glucuronidation by UGT1A1 is the dominant pathway of the metabolic disposition of belinostat in liver cancer patients. PLoS One. 2013;8(1):e54522.
• [626] Phase I dose-escalation study of EZN-2208 (PEG-SN38), a novel conjugate of poly(ethylene) glycol and SN38, administered weekly in patients with advanced cancer. Cancer Chemother Pharmacol. 2013 Jun;71(6):1499-506.
• [627] Metabolic activation of pradefovir by CYP3A4 and its potential as an inhibitor or inducer. Antimicrob Agents Chemother. 2006 Sep;50(9):2926-31.
• [628] Metabolism of the trisubstituted purine cyclin-dependent kinase inhibitor seliciclib (R-roscovitine) in vitro and in vivo. Drug Metab Dispos. 2008 Mar;36(3):561-70.
• [629] TB and HIV therapeutics: pharmacology research priorities. AIDS Res Treat. 2012;2012:874083.
• [630] Cytochromes P450 and experimental models of drug metabolism. J Cell Mol Med. 2002 Apr-Jun;6(2):189-98.
• [631] A new compound-specific pleiotropic effect of statins: modification of plasma gamma-tocopherol levels. Atherosclerosis. 2007 Jul;193(1):229-33.
• [632] Characterization of the pharmacokinetics of vilaprisan: bioavailability, excretion, biotransformation, and drug-drug interaction potential. Clin Pharmacokinet. 2018 Aug;57(8):1001-1015.
• [633] Assessment of drug-drug interaction potential and PBPK modeling of CC-223, a potent inhibitor of the mammalian target of rapamycin kinase. Xenobiotica. 2019 Jan;49(1):54-70.
• [634] Cytotoxicity of chloroacetanilide herbicide alachlor in HepG2 cells independent of CYP3A4 and CYP3A7. Food Chem Toxicol. 2007 May;45(5):871-7.
• [635] Nonclinical pharmacokinetics and in vitro metabolism of H3B-6545, a novel selective ERalpha covalent antagonist (SERCA). Cancer Chemother Pharmacol. 2019 Jan;83(1):151-160.
• [636] Biotransformation of tirilazad in human: 1. Cytochrome P450 3A-mediated hydroxylation of tirilazad mesylate in human liver microsomes. J Pharmacol Exp Ther. 1996 May;277(2):982-90.
• [637] Phase I study of LY2940680, a Smo antagonist, in patients with advanced cancer including treatment-naive and previously treated basal cell carcinoma. Clin Cancer Res. 2018 May 1;24(9):2082-2091.
• [638] Preclinical metabolism and pharmacokinetics of SB1317 (TG02), a potent CDK/JAK2/FLT3 inhibitor. Drug Metab Lett. 2012 Mar;6(1):33-42.
• [639] Metabolism and disposition of hepatitis C polymerase inhibitor dasabuvir in humans. Drug Metab Dispos. 2016 Aug;44(8):1139-47.
• [640] MedChemExpress: AZD3839.
• [641] Metabolism of F18, a derivative of calanolide A, in human liver microsomes and cytosol. Front Pharmacol. 2017 Jul 19;8:479.
• [642] Identification of enzymes responsible for primary and sequential oxygenation reactions of capravirine in human liver microsomes. Drug Metab Dispos. 2006 Nov;34(11):1798-802.
• [643] Using chimeric mice with humanized livers to predict human drug metabolism and a drug-drug interaction. J Pharmacol Exp Ther. 2013 Feb;344(2):388-96.
• [644] Bictegravir, a novel integrase inhibitor for the treatment of HIV infection. Drugs Today (Barc). 2019 Nov;55(11):669-682.
• [645] Correlation of the in vitro biotransformation of H3B-6527 in dog and human hepatocytes with the in vivo metabolic profile of 14C-H3B-6527 in a dog mass balance study. Xenobiotica. 2020 Apr;50(4):458-467.
• [646] ITX 5061 quantitation in human plasma with reverse phase liquid chromatography and mass spectrometry detection. Antivir Ther. 2013;18(3):329-36.
• [647] Robust central reduction of amyloid-beta in humans with an orally available, non-peptidic beta-secretase inhibitor. J Neurosci. 2011 Nov 16;31(46):16507-16.
• [648] Effect of mibefradil on CYP3A4 in vivo. J Clin Pharmacol. 2003 Oct;43(10):1091-100.
• [649] MLN8054 and Alisertib (MLN8237): discovery of selective oral aurora A inhibitors. ACS Med Chem Lett. 2015 Apr 22;6(6):630-4.
• [650] Sex differences in rat hepatic cytolethality of the protein kinase C inhibitor safingol: role of biotransformation. Toxicol Appl Pharmacol. 1996 Apr;137(2):173-81.
• [651] Effect of glimepiride on the pharmacokinetics of teneligliptin in healthy Korean subjects. J Clin Pharm Ther. 2019 Oct;44(5):720-725.
• [652] Assessment of the stereoselective metabolism of methaqualone in man by capillary electrophoresis. Electrophoresis. 2003 Aug;24(15):2598-607.
• [653] Involvement of CYP2E1 as A low-affinity enzyme in phenacetin O-deethylation in human liver microsomes. Drug Metab Dispos. 1999 Aug;27(8):860-5.
• [654] Hepatic veno-occlusive disease associated with immunosuppressive cyclophosphamide dosing and roxithromycin. Ann Pharmacother. 2006 Apr;40(4):767-70.
• [655] Metabolic drug interactions with newer antipsychotics: a comparative review. Basic Clin Pharmacol Toxicol. 2007 Jan;100(1):4-22.
• [656] Evidence for the bioactivation of zomepirac and tolmetin by an oxidative pathway: identification of glutathione adducts in vitro in human liver microsomes and in vivo in rats. Drug Metab Dispos. 2006 Jan;34(1):145-51.
• [657] Hepatotoxicity observed in clinical trials of aplaviroc (GW873140). Antimicrob Agents Chemother. 2008 Mar;52(3):858-65.
• [658] Identification of cytochromes P450 involved in the human liver microsomal metabolism of the thromboxane A2 inhibitor seratrodast (ABT-001). Drug Metab Dispos. 1997 Jan;25(1):110-5.
• [659] Seville (sour) orange juice: synephrine content and cardiovascular effects in normotensive adults. J Clin Pharmacol. 2001 Oct;41(10):1059-63.
• [660] In vitro evaluation of potential in vivo probes for human flavin-containing monooxygenase (FMO): metabolism of benzydamine and caffeine by FMO and P450 isoforms. Br J Clin Pharmacol. 2000 Oct;50(4):311-4.
• [661] Pharmacokinetic assessment of the sites of first-pass metabolism of BMS-181101, an antidepressant agent, in rats. J Pharm Pharmacol. 1998 Mar;50(3):275-8.
• [662] Antiviral activity, pharmacokinetics, and safety of BMS-488043, a novel oral small-molecule HIV-1 attachment inhibitor, in HIV-1-infected subjects. Antimicrob Agents Chemother. 2011 Feb;55(2):722-8.
• [663] Metabolism of ezlopitant, a nonpeptidic substance P receptor antagonist, in liver microsomes: enzyme kinetics, cytochrome P450 isoform identity, and in vitro-in vivo correlation. Drug Metab Dispos. 2000 Sep;28(9):1069-76.
• [664] GW766994 CCR3 receptor antagonist.
• [665] Cytochrome P450 Involvement in the biotransformation of cisapride and racemic norcisapride in vitro: differential activity of individual human CYP3A isoforms. Drug Metab Dispos. 2001 Dec;29(12):1548-54.
• [666] Induction of CYP3As in HepG2 cells by several drugs. Association between induction of CYP3A4 and expression of glucocorticoid receptor. Biol Pharm Bull. 2003 Apr;26(4):510-7.
• [667] Stereoselective pharmacokinetics of RS-8359, a selective and reversible MAO-A inhibitor, by species-dependent drug-metabolizing enzymes. Chirality. 2005 Mar;17(3):135-41.
• [668] Effects of tesmilifene, a substrate of CYP3A and an inhibitor of P-glycoprotein, on the pharmacokinetics of intravenous and oral docetaxel in rats. J Pharm Pharmacol. 2010 Aug;62(8):1084-8.
• [669] Pharmacokinetics, metabolism, and excretion of torcetrapib, a cholesteryl ester transfer protein inhibitor, in humans. Drug Metab Dispos. 2008 Nov;36(11):2185-98.
• [670] Bioreductive GDEPT using cytochrome P450 3A4 in combination with AQ4N. Cancer Gene Ther. 2003 Jan;10(1):40-8.
• [671] Metabolism of mofarotene in hepatocytes and liver microsomes from different species. Comparison with in vivo data and evaluation of the cytochrome P450 isoenzymes involved in human biotransformation. Drug Metab Dispos. 1995 Oct;23(10):1051-7.
• [672] Identification of cytochrome P4503A as the major subfamily responsible for the metabolism of roquinimex in man. Xenobiotica. 2000 Sep;30(9):905-14.
• [673] Metabolism of vanoxerine, 1-[2-[bis(4-fluorophenyl)methoxy]ethyl]-4-(3-phenylpropyl)piperazine, by human cytochrome P450 enzymes. Drug Metab Dispos. 2001 Sep;29(9):1216-20.
• [674] Tricyclic antidepressant pharmacology and therapeutic drug interactions updated. Br J Pharmacol. 2007 Jul;151(6):737-48.
• [675] Metabolism and disposition of prescription opioids: a review. Forensic Sci Rev. 2015 Jul;27(2):115-45.
• [676] Identification of the human P450 enzymes involved in the in vitro metabolism of the synthetic steroidal hormones Org 4060 and Org 30659. Xenobiotica. 2002 Feb;32(2):109-18.
• [677] The critical role of oxidative stress in the toxicity and metabolism of quinoxaline 1,4-di-N-oxides in vitro and in vivo. Drug Metab Rev. 2016 May;48(2):159-82.
• [678] Cytochrome P450 responsible for the stereoselective S-oxidation of flosequinan in hepatic microsomes from rats and humans. Drug Metab Dispos. 1997 Jun;25(6):716-24.
• [679] Metabolism of the newest antidepressants: comparisons with related predecessors. IDrugs. 2004 Feb;7(2):143-50.
• [680] The mechanism of aphidicolin bioinactivation by rat liver in vitro systems. Xenobiotica. 1990 Mar;20(3):273-87.
• [681] Studies on pharmacokinetic drug interaction potential of vinpocetine. Medicines (Basel). 2015 Jun 5;2(2):93-105.
• [682] Human liver oxidative metabolism of O6-benzylguanine. Biochem Pharmacol. 1995 Oct 26;50(9):1385-9.
• [683] CYP3A4 and CYP2A6 activities marked by the metabolism of lignocaine and coumarin in patients with liver and kidney diseases and epileptic patients. Br J Clin Pharmacol. 1995 Jan;39(1):71-6.
• [684] P450 enzyme expression patterns in the NCI human tumor cell line panel. Drug Metab Dispos. 2001 Mar;29(3):304-12.
• [685] Metabolism of butyrylfentanyl in fresh human hepatocytes: chemical synthesis of authentic metabolite standards for definitive identification. Biol Pharm Bull. 2019;42(4):623-630.
• [686] CYP3A time-dependent inhibition risk assessment validated with 400 reference drugs. Drug Metab Dispos. 2011 Jun;39(6):1039-46.
• [687] Structure and mechanism of the complex between cytochrome P4503A4 and ritonavir. Proc Natl Acad Sci U S A. 2010 Oct 26;107(43):18422-7.
• [688] Characterization of human cytochrome P450 enzymes involved in the metabolism of cyamemazine. Eur J Pharm Sci. 2007 Dec;32(4-5):357-66.
• [689] The naphthol selective estrogen receptor modulator (SERM), LY2066948, is oxidized to an o-quinone analogous to the naphthol equine estrogen, equilenin. Chem Biol Interact. 2012 Mar 5;196(1-2):1-10.
• [690] Diet Drug Porfimer sodium Safe, Effective, Study Finds.
• [691] Metabolic activation of aromatic amines by human pancreas. Carcinogenesis. 1997 May;18(5):1085-92.
• [692] Major pathway of imipramine metabolism is catalyzed by cytochromes P-450 1A2 and P-450 3A4 in human liver. Mol Pharmacol. 1993 May;43(5):827-32.
• [693] Midazolam and other benzodiazepines. Handb Exp Pharmacol. 2008;(182):335-60.
• [694] Metabolism of medroxyprogesterone acetate (MPA) via CYP enzymes in vitro and effect of MPA on bleeding time in female rats in dependence on CYP activity in vivo. Life Sci. 2003 Nov 7;73(25):3201-12.
• [695] Quinacrine is mainly metabolized to mono-desethyl quinacrine by CYP3A4/5 and its brain accumulation is limited by P-glycoprotein. Drug Metab Dispos. 2006 Jul;34(7):1136-44.
• [696] Inhibition of triazolam clearance by macrolide antimicrobial agents: in vitro correlates and dynamic consequences. Clin Pharmacol Ther. 1998 Sep;64(3):278-85.
• [697] Sigmoidal kinetic model for two co-operative substrate-binding sites in a cytochrome P450 3A4 active site: an example of the metabolism of diazepam and its derivatives. Biochem J. 1999 Jun 15;340 ( Pt 3):845-53.
• [698] Diazinon, chlorpyrifos and parathion are metabolised by multiple cytochromes P450 in human liver. Toxicology. 2006 Jul 5;224(1-2):22-32.
• [699] Stereoselective disposition of talinolol in man. J Pharm Sci. 2002 Feb;91(2):303-11.
• [700] 6alpha-hydroxylation of taurochenodeoxycholic acid and lithocholic acid by CYP3A4 in human liver microsomes. Biochim Biophys Acta. 1999 Apr 19;1438(1):47-54.