Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT3ROYC)

• DTT Name: Serotonin transporter (SERT)
• Synonyms: Solute carrier family 6 member 4; HTT; 5HTT; 5HT transporter
• Gene Name: SLC6A4
• DTT Type: Successful target; [1]
• BioChemical Class: Neurotransmitter:sodium symporter
• UniProt ID: SC6A4_HUMAN
• TTD ID: T27812
• Sequence:
  METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
  HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
  YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
  AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
  RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
  TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
  ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
  TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
  LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
  WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
  PGTFKERIIKSITPETPTEIPCGDIRLNAV
• Function: Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner. Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization.
• KEGG Pathway: Serotonergic synapse (hsa04726)
• Reactome Pathway: Serotonin clearance from the synaptic cleft (R-HSA-380615)

Molecular Interaction Atlas (MIA) of This DTT

26 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Acetaminophen	DMUIE76	Allergic rhinitis	CA08.0	Approved	[2]
Amfepramone	DM9YSNQ	Migraine	8A80	Approved	[3]
Amitriptyline	DMK7F9S	Depression	6A70-6A7Z	Approved	[4]
Bupropion	DM5PCS7	Depression	6A70-6A7Z	Approved	[5]
Chlorphentermine Hydrochloride	DMQRPOS	Appetite suppressant	MG43	Approved	[6]
Citalopram	DM2G9AE	Acute coronary syndrome	BA41	Approved	[7]
Clomipramine	DMINRKW	Depression	6A70-6A7Z	Approved	[8]
Cocaine	DMSOX7I	Anaesthesia	9A78.6	Approved	[9]
Dasotraline	DMLDQFV	Attention deficit hyperactivity disorder	6A05.Z	Approved	[10]
Desvenlafaxine	DMHD4PE	Major depressive disorder	6A70.3	Approved	[11]
Dextromethorphan Polistirex	DMEHCY5	Dry cough	MD12	Approved	[7]
Duloxetine	DM9BI7M	Depression	6A70-6A7Z	Approved	[12]
Escitalopram	DMFK9HG	Major depressive disorder	6A70.3	Approved	[13]
Fluoxetine	DM3PD2C	Bipolar depression		Approved	[7]
Fluvoxamine	DMQTJSX	Depression	6A70-6A7Z	Approved	[14]
Levomilnacipran	DMV26S8	Fibromyalgia	MG30.01	Approved	[15]
Luvox	DMJKROX	Anxiety disorder	6B00-6B0Z	Approved	[16]
Nortriptyline	DM4KDYJ	Depression	6A70-6A7Z	Approved	[7]
Paroxetine	DM5PVQE	Anxiety disorder	6B00-6B0Z	Approved	[7]
Sertraline	DM0FB1J	Coronary heart disease	BA80.Z	Approved	[1]
Sibutramine	DMFJTDI	Obesity	5B81	Approved	[7]
Tianeptine	DMYN8MA	Major depressive disorder	6A70.3	Approved	[17]
Trazodone	DMK1GBJ	Depression	6A70-6A7Z	Approved	[7]
Venlafaxine	DMR6QH0	Anxiety disorder	6B00-6B0Z	Approved	[5]
Vilazodone	DM4LECQ	Major depressive disorder	6A70.3	Approved	[18]
Vortioxetine	DM6F1PU	Major depressive disorder	6A70.3	Approved	[19]

17 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Amitifadine	DMS1X67	Obesity	5B81	Phase 3	[20]
AVP-786	DMV1SOR	Alzheimer disease	8A20	Phase 3	[21]
Bicifadine	DM42GP9	Chronic low back pain	MG30.02	Phase 3	[22]
ITI-007	DMUQ1DO	Depression	6A70-6A7Z	Phase 3	[23]
LITOXETINE	DMKZRBP	Mood disorder	6A60-6E23	Phase 3	[24]
Brasofensine	DM3TRF7	Parkinson disease	8A00.0	Phase 2	[25]
CLR-3001	DM3Z6IQ	Major depressive disorder	6A70.3	Phase 2	[26]
DA-8031	DMP6MH9	Premature ejaculation	HA03.0Z	Phase 2	[27]
Lu-AA34893	DM2ZUXK	Anxiety disorder	6B00-6B0Z	Phase 2	[28]
MIN-117	DMSLIW6	Major depressive disorder	6A70.3	Phase 2	[29]
NS 2359	DMI5HFU	Cocaine addiction	6C45.2	Phase 2	[30]
TD-9855	DMQD5NA	Pain	MG30-MG3Z	Phase 2	[31]
AD-337	DM8VQ1S	Chemotherapy-induced nausea	MD90	Phase 1	[16]
BGC-20-1259	DMED4AJ	Parkinson disease	8A00.0	Phase 1	[32]
BL-1021	DMAYSFK	Pain	MG30-MG3Z	Phase 1	[33]
GSK-1360707	DMZC9XU	Major depressive disorder	6A70.3	Phase 1	[34]
SEP-228432	DMF89ZT	Depression	6A70-6A7Z	Phase 1	[35]

3 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Citalopram derivative 1	DMITX1G	N. A.	N. A.	Patented	[36]
Piperidine derivative 1	DMHN5KW	N. A.	N. A.	Patented	[36]
PMID29334795-Compound-61	DM9H3LI	N. A.	N. A.	Patented	[36]

15 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Dexfenfluramine	DMJ7YDS	Obesity	5B81	Withdrawn from market	[37]
ZIMELIDINE	DMNI3U2	Depression	6A70-6A7Z	Withdrawn from market	[38]
DOV-216303	DMTE14H	Mood disorder	6A60-6E23	Discontinued in Phase 2	[30]
NS-2389	DMVRJ8D	Major depressive disorder	6A70.3	Discontinued in Phase 2	[39]
OxycoDex	DMHFOIX	Pain	MG30-MG3Z	Discontinued in Phase 2	[21]
R-sibutramine metabolite	DMPAH74	Attention deficit hyperactivity disorder	6A05.Z	Discontinued in Phase 2	[40]
SPD-473	DMTJNRL	Mood disorder	6A60-6E23	Discontinued in Phase 2	[41]
YM-992	DM845NM	Depression	6A70-6A7Z	Discontinued in Phase 2	[42]
NSD-644	DMNL9DS	Neurological disorder	6B60	Discontinued in Phase 1	[43]
RG-7166	DMKLPMW	Major depressive disorder	6A70.3	Discontinued in Phase 1	[44]
6-nitroquipazine	DM5MVF9	N. A.	N. A.	Terminated	[45]
A-80426	DMBC3DG	N. A.	N. A.	Terminated	[46]
HydrocoDex	DM4HA9C	Pain	MG30-MG3Z	Terminated	[21]
Irindalone	DMJ3ZUN	Inflammation	1A00-CA43.1	Terminated	[47]
MOXIFETIN HYDROGEN MALEATE	DMO2S6T	Mood disorder	6A60-6E23	Terminated	[48]

232 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
((3R,4R)-4-(o-tolyloxy)chroman-3-yl)methanamine	DM2TIU3	Discovery agent	N.A.	Investigative	[49]
(+/-)-3-((naphthalen-2-yloxy)methyl)pyrrolidine	DML68KX	Discovery agent	N.A.	Investigative	[50]
(+/-)-nantenine	DM0L3GE	Discovery agent	N.A.	Investigative	[51]
(2R,3R)-iodoreboxetine	DMYRHFI	Discovery agent	N.A.	Investigative	[52]
(2R,3S)-2-[(2-Iodophenoxy)phenylmethyl]morpholine	DMY2FX8	Discovery agent	N.A.	Investigative	[53]
(2R,3S)-2-[(3-Iodophenoxy)phenylmethyl]morpholine	DM260TI	Discovery agent	N.A.	Investigative	[53]
(2R,3S)-2-[(4-Iodophenoxy)phenylmethyl]morpholine	DMKM8E2	Discovery agent	N.A.	Investigative	[53]
(2S,3S)-iodoreboxetine	DMBEOIQ	Discovery agent	N.A.	Investigative	[52]
(cis)-1,6-diphenyl-3-aza-bicyclo[3.1.0]hexane	DMMC139	Discovery agent	N.A.	Investigative	[54]
(R)-2-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol	DM74IWX	Discovery agent	N.A.	Investigative	[55]
(R)-3-(naphthalen-2-ylmethoxy)pyrrolidine	DM94B12	Discovery agent	N.A.	Investigative	[50]
(R)-6-(pyrrolidin-3-ylmethoxy)-2-naphthonitrile	DM134UV	Discovery agent	N.A.	Investigative	[50]
(R)-DULOXETINE	DMECK7H	Discovery agent	N.A.	Investigative	[56]
(R)-N-isobutyl-N-(pyrrolidin-3-yl)-2-naphthamide	DMJFH97	Discovery agent	N.A.	Investigative	[57]
(R)-N-isopropyl-N-(pyrrolidin-3-yl)-2-naphthamide	DMQIUOB	Discovery agent	N.A.	Investigative	[57]
(R)-Norfluoxetine	DMS30KU	Discovery agent	N.A.	Investigative	[58]
(S)-3-(naphthalen-2-ylmethoxy)pyrrolidine	DM5ILK1	Discovery agent	N.A.	Investigative	[50]
(S)-6-(pyrrolidin-3-ylmethoxy)-2-naphthonitrile	DM32PJ5	Discovery agent	N.A.	Investigative	[50]
(S)-N-isobutyl-N-(pyrrolidin-3-yl)-2-naphthamide	DMUAYZJ	Discovery agent	N.A.	Investigative	[57]
(S)-NORDULOXETINE	DMULFYA	Discovery agent	N.A.	Investigative	[59]
(S)-Norfluoxetine	DM8ZTPF	Discovery agent	N.A.	Investigative	[58]
1-(1,2-diphenylethyl)piperazine	DM0ARKB	Discovery agent	N.A.	Investigative	[60]
1-(1,3-diphenylpropyl)piperazine	DMTC98X	Discovery agent	N.A.	Investigative	[61]
1-(1,4-diphenylbutan-2-yl)piperazine	DM8Z1QU	Discovery agent	N.A.	Investigative	[61]
1-(1-(2-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX)	DMCSOAV	Discovery agent	N.A.	Investigative	[55]
1-(1-(4-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX)	DMS9PZ7	Discovery agent	N.A.	Investigative	[55]
1-(1-phenyl-2-(2-propoxyphenyl)ethyl)piperazine	DM54ZKU	Discovery agent	N.A.	Investigative	[55]
1-(1-phenyl-2-(pyridin-2-yl)ethyl)piperazine	DMIZBP6	Discovery agent	N.A.	Investigative	[61]
1-(1-phenyl-2-(pyridin-4-yl)ethyl)piperazine	DMTVPZC	Discovery agent	N.A.	Investigative	[61]
1-(1-phenyl-2-o-tolylethyl)piperazine	DMZ6QX0	Discovery agent	N.A.	Investigative	[60]
1-(2-((3-fluorophenoxy)methyl)phenyl)piperazine	DMJXKOF	Discovery agent	N.A.	Investigative	[62]
1-(2-(2-(DIFLUOROMETHOXY)PHENYL)-1-PHENYLETHYL)PIPERAZINE (ENANTIOMERIC MIX)	DMUJ2WB	Discovery agent	N.A.	Investigative	[55]
1-(2-(2-bromophenyl)-1-phenylethyl)piperazine	DMPRALC	Discovery agent	N.A.	Investigative	[60]
1-(2-(2-chlorophenyl)-1-phenylethyl)piperazine	DMUM4YQ	Discovery agent	N.A.	Investigative	[60]
1-(2-(2-ethoxyphenyl)-1-phenylethyl)piperazine	DMBRS3D	Discovery agent	N.A.	Investigative	[60]
1-(2-(2-ethylphenyl)-1-phenylethyl)piperazine	DMKWRCD	Discovery agent	N.A.	Investigative	[60]
1-(2-(2-fluorobenzyloxy)phenyl)piperazine	DM6XCPV	Discovery agent	N.A.	Investigative	[62]
1-(2-(2-methoxyphenyl)-1-phenylethyl)piperazine	DM2H38V	Discovery agent	N.A.	Investigative	[55]
1-(2-(3-chlorophenyl)-1-phenylethyl)piperazine	DM4WEGM	Discovery agent	N.A.	Investigative	[60]
1-(2-(3-fluorophenoxy)phenyl)piperazine	DMXV2KQ	Discovery agent	N.A.	Investigative	[62]
1-(2-(3-methoxyphenyl)-1-phenylethyl)piperazine	DM8V5IH	Discovery agent	N.A.	Investigative	[60]
1-(2-(4-fluorophenoxy)phenyl)piperazine	DMU082P	Discovery agent	N.A.	Investigative	[62]
1-(2-(6-fluoronaphthalen-2-yl)ethyl)piperazine	DMR4DJ1	Discovery agent	N.A.	Investigative	[50]
1-(2-(benzyloxy)phenyl)piperazine	DM0UZHL	Discovery agent	N.A.	Investigative	[62]
1-(2-(naphthalen-1-yl)-1-phenylethyl)piperazine	DMXL7Z5	Discovery agent	N.A.	Investigative	[61]
1-(2-(naphthalen-2-yl)-1-phenylethyl)piperazine	DMTEBP0	Discovery agent	N.A.	Investigative	[61]
1-(2-(naphthalen-2-yl)ethyl)piperazine	DMS7YF6	Discovery agent	N.A.	Investigative	[50]
1-(2-(phenoxymethyl)phenyl)piperazine	DM7Z19T	Discovery agent	N.A.	Investigative	[62]
1-(2-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMBWCOZ	Discovery agent	N.A.	Investigative	[63]
1-(2-phenoxyphenyl)piperazine	DMWFCYN	Discovery agent	N.A.	Investigative	[62]
1-(3,4-Dichloro-phenyl)-3-diethylamino-indan-5-ol	DMN4JU0	Discovery agent	N.A.	Investigative	[64]
1-(3,4-Dichloro-phenyl)-3-methylamino-indan-5-ol	DMWIEDN	Discovery agent	N.A.	Investigative	[64]
1-(3-chlorophenyl)-2-(piperidin-1-yl)propan-1-one	DMPOVUY	Discovery agent	N.A.	Investigative	[65]
1-(3-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMPEZ1V	Discovery agent	N.A.	Investigative	[63]
1-(3-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMB9T6F	Discovery agent	N.A.	Investigative	[63]
1-(4-Benzylsulfanyl-phenyl)-propylamine	DMXV9S7	Discovery agent	N.A.	Investigative	[66]
1-(4-bromophenyl)-2-(tert-butylamino)propan-1-one	DMW6YDK	Discovery agent	N.A.	Investigative	[67]
1-(4-bromophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMPLEC0	Discovery agent	N.A.	Investigative	[63]
1-(4-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMBV8PT	Discovery agent	N.A.	Investigative	[63]
1-(4-nitrophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DME435S	Discovery agent	N.A.	Investigative	[63]
1-(benzofuran-2-yl)-3-aza-bicyclo[3.1.0]hexane	DMGNL2A	Discovery agent	N.A.	Investigative	[54]
1-(naphthalen-2-yl)-3-aza-bicyclo[3.1.0]hexane	DMUEQC8	Discovery agent	N.A.	Investigative	[54]
1-(thiophen-2-yl)-3-aza-bicyclo[3.1.0]hexane	DM6J1AK	Discovery agent	N.A.	Investigative	[54]
1-benzylpiperidine hydrochloride	DM7GDEK	Discovery agent	N.A.	Investigative	[68]
1-Biphenyl-4-yl-3-aza-bicyclo[3.1.0]hexane	DM6E7TA	Discovery agent	N.A.	Investigative	[54]
1-fluoro-5-phenyl-3-aza-bicyclo[3.1.0]hexane	DM0Q46C	Discovery agent	N.A.	Investigative	[54]
1-Methyl-2-(4-phenylsulfanyl-phenyl)-ethylamine	DMYU348	Discovery agent	N.A.	Investigative	[66]
1-Methyl-4-p-tolyl-piperidine-4-carbonitrile	DM6XFMT	Discovery agent	N.A.	Investigative	[69]
1-naphthalen-2-yl-2-pyrrolidin-1-yl-pentan-1-one	DMU04ZQ	Discovery agent	N.A.	Investigative	[63]
1-phenyl-3-aza-bicyclo[3.1.0]hexane	DMUA72F	Discovery agent	N.A.	Investigative	[54]
10R-hydroxylobel-7-ene	DM8XRCT	Discovery agent	N.A.	Investigative	[70]
10R-hydroxylobelane	DMN93QT	Discovery agent	N.A.	Investigative	[70]
10S-hydroxylobel-7-ene	DMN1YQ6	Discovery agent	N.A.	Investigative	[70]
10S-hydroxylobelane	DM54AKV	Discovery agent	N.A.	Investigative	[70]
1S,2R-milnacipran	DM7Y5AN	Discovery agent	N.A.	Investigative	[71]
2-(2'-Aminoethyl)-5-benzyltetrahydrofuran	DMVTD1F	Discovery agent	N.A.	Investigative	[72]
2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine	DM1ULEX	Discovery agent	N.A.	Investigative	[73]
2-(2-fluorophenoxy)-3-(piperidin-4-yl)pyridine	DM1SN37	Discovery agent	N.A.	Investigative	[73]
2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine	DMYVDJQ	Discovery agent	N.A.	Investigative	[73]
2-(2-phenyl-2-(piperazin-1-yl)ethyl)benzonitrile	DMO9SP1	Discovery agent	N.A.	Investigative	[60]
2-(3-Methyl-piperazin-1-yl)-6-nitro-quinoline	DM1J4MT	Discovery agent	N.A.	Investigative	[74]
2-(Aminomethyl)-5-(1'-naphthethyl)tetrahydrofuran	DMU4MIC	Discovery agent	N.A.	Investigative	[72]
2-(Aminomethyl)-5-(1'-naphthyl)tetrahydrofuran	DMCUTY9	Discovery agent	N.A.	Investigative	[72]
2-(Aminomethyl)-5-(2'-naphthyl)tetrahydrofuran	DM157SO	Discovery agent	N.A.	Investigative	[72]
2-(Aminomethyl)-5-phenethyltetrahydrofuran	DMEZ7O2	Discovery agent	N.A.	Investigative	[72]
2-(N-Cyclopentylamino)-3'-methoxypropiophenone	DMVN1UI	Discovery agent	N.A.	Investigative	[67]
2-(N-Cyclopropylamino)-3-chloropropiophenone	DMNMES3	Discovery agent	N.A.	Investigative	[65]
2-(N-tert-Butylamino)-3',4'-dichloropropiophenone	DMKIEVP	Discovery agent	N.A.	Investigative	[65]
2-(tert-butylamino)-1-(3-chlorophenyl)butan-1-one	DMI457Y	Discovery agent	N.A.	Investigative	[67]
2-(tert-Butylamino)-3',4'-dichlorobutyrophenone	DMOJK8Y	Discovery agent	N.A.	Investigative	[65]
2-(tert-Butylamino)-3',4'-dichloropentanophenone	DMMUDQ7	Discovery agent	N.A.	Investigative	[65]
2-Amino-1-(4-ethylthiophenyl)butane	DM73FWA	Discovery agent	N.A.	Investigative	[66]
2-Amino-1-(4-ethylthiophenyl)propane	DMS5LKR	Discovery agent	N.A.	Investigative	[66]
2-Amino-1-(4-methylthiophenyl)butane	DMW7N3H	Discovery agent	N.A.	Investigative	[66]
2-Amino-1-(4-methylthiophenyl)propane	DMJ2Z9G	Discovery agent	N.A.	Investigative	[66]
2-Aminomethyl-5-(p-bromophenyl)tetrahydrofuran	DMCJUWK	Discovery agent	N.A.	Investigative	[72]
2-Aminomethyl-5-(p-chlorophenyl)tetrahydrofuran	DM3OTZY	Discovery agent	N.A.	Investigative	[72]
2-Aminomethyl-5-(p-methoxyphenyl)tetrahydrofuran	DMDG8FL	Discovery agent	N.A.	Investigative	[72]
2-Aminomethyl-5-(p-t-butylphenyl)tetrahydrofuran	DME4P7K	Discovery agent	N.A.	Investigative	[72]
2-Aminomethyl-5-(phenyl)tetrahydrofuran	DM413ZB	Discovery agent	N.A.	Investigative	[72]
2-N,N-Dimethylamino-1-(4-methylthiophenyl)propane	DMKSUVH	Discovery agent	N.A.	Investigative	[66]
2-N-(Isopropyl)amino-1-(4-methylthiophenyl)butane	DM0PT8R	Discovery agent	N.A.	Investigative	[66]
2-N-(n-Propyl)amino-1-(4-methylthiophenyl)butane	DMLJ30O	Discovery agent	N.A.	Investigative	[66]
2-N-Allylamino-1-(4-methylthiophenyl)propan	DM5S0BY	Discovery agent	N.A.	Investigative	[66]
2-N-Cyclopropylamino-1-(4-methylthiophenyl)butane	DMS0NW3	Discovery agent	N.A.	Investigative	[66]
2-N-Ethylamino-1-(4-ethylthiophenyl)butane	DMCYVS0	Discovery agent	N.A.	Investigative	[66]
2-N-Ethylamino-1-(4-ethylthiophenyl)propane	DM64093	Discovery agent	N.A.	Investigative	[66]
2-N-Ethylamino-1-(4-methylthiophenyl)butane	DMKA3V2	Discovery agent	N.A.	Investigative	[66]
2-N-Ethylamino-1-(4-methylthiophenyl)propane	DM6O1SY	Discovery agent	N.A.	Investigative	[66]
2-N-Hydroxyamino-1-(4-ethylthiophenyl)butane	DM2MH6J	Discovery agent	N.A.	Investigative	[66]
2-N-Hydroxyamino-1-(4-ethylthiophenyl)propane	DMIQGWK	Discovery agent	N.A.	Investigative	[66]
2-N-Hydroxyamino-1-(4-methylthiophenyl)butane	DME41NR	Discovery agent	N.A.	Investigative	[66]
2-N-Hydroxyamino-1-(4-methylthiophenyl)propane	DMZDYCW	Discovery agent	N.A.	Investigative	[66]
2-N-Methoxyamino-1-(4-methylthiophenyl)propane	DMHCVKJ	Discovery agent	N.A.	Investigative	[66]
2-N-Methylamino-1-(4-ethylthiophenyl)propane	DM1X5RY	Discovery agent	N.A.	Investigative	[66]
2-N-Methylamino-1-(4-methylthiophenyl)butane	DMCR49K	Discovery agent	N.A.	Investigative	[66]
2-N-Methylamino-1-(4-methylthiophenyl)propane	DMVLX1T	Discovery agent	N.A.	Investigative	[66]
2-N-Propargylamino-1-(4-methylthiophenyl)butane	DMLZCOU	Discovery agent	N.A.	Investigative	[66]
2-N-Propargylamino-1-(4-methylthiophenyl)propane	DM9HPG1	Discovery agent	N.A.	Investigative	[66]
2-Naphthalen-2-ylmethyl-4,5-dihydro-1H-imidazole	DMNMEPB	Discovery agent	N.A.	Investigative	[46]
2-phenoxy-3-(piperidin-4-yl)pyridine	DM6JNT5	Discovery agent	N.A.	Investigative	[73]
2-[1,4]Diazepan-1-yl-6-nitro-quinoline	DMEA2SR	Discovery agent	N.A.	Investigative	[74]
3-(1H-indol-1-yl)-N-methyl-3-phenylpropan-1-amine	DMLV80B	Discovery agent	N.A.	Investigative	[75]
3-(1H-indol-3-yl)-N,N-dimethylpropan-1-amine	DM6Y2XK	Discovery agent	N.A.	Investigative	[76]
3-(2-phenyl-2-(piperazin-1-yl)ethyl)benzamide	DM0YEGM	Discovery agent	N.A.	Investigative	[60]
3-(2-phenyl-2-(piperazin-1-yl)ethyl)benzonitrile	DM6YJOU	Discovery agent	N.A.	Investigative	[60]
3-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol	DM6QZTB	Discovery agent	N.A.	Investigative	[60]
3-(3,4-dichlorophenyl)-2-nortropene	DMT3AW8	Discovery agent	N.A.	Investigative	[77]
3-(3-aminocyclopentyl)-1H-indole-5-carbonitrile	DMB6SP8	Discovery agent	N.A.	Investigative	[78]
3-(4-Chlorophenyl)-2-nortropene	DM71EUO	Discovery agent	N.A.	Investigative	[77]
3-(4-Fluorophenyl)-2-nortropene	DM8CK9M	Discovery agent	N.A.	Investigative	[77]
3-(4-Trifluoromethylphenyl)-2-nortropene	DMZB804	Discovery agent	N.A.	Investigative	[77]
3-(piperidin-4-yl)-2-(o-tolyloxy)pyridine	DM2ETXB	Discovery agent	N.A.	Investigative	[73]
3-alpha-Phenylmethoxy-3-beta-phenyl-nortropane	DMO5IJA	Discovery agent	N.A.	Investigative	[77]
3-Bromo-6-nitro-2-piperazin-1-yl-quinoline	DMXZB5C	Discovery agent	N.A.	Investigative	[74]
3-p-Tolyl-8-aza-bicyclo[3.2.1]octane	DM0872E	Discovery agent	N.A.	Investigative	[79]
3-Phenyl-2-nortropene	DMAJMU6	Discovery agent	N.A.	Investigative	[77]
3alpha-(bis-chloro-phenylmethoxy)tropane	DMBUZWQ	Discovery agent	N.A.	Investigative	[80]
4-((naphthalen-2-yloxy)methyl)piperidine	DMIQHYZ	Discovery agent	N.A.	Investigative	[50]
4-(1H-indol-3-yl)-N,N-dimethylcyclohex-3-enamine	DM7Y1ZD	Discovery agent	N.A.	Investigative	[81]
4-(2-((3-fluorophenoxy)methyl)phenyl)piperidine	DMJ9CNA	Discovery agent	N.A.	Investigative	[62]
4-(2-((dimethylamino)methyl)phenoxy)benzonitrile	DM0MWVU	Discovery agent	N.A.	Investigative	[82]
4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine	DM9UA0N	Discovery agent	N.A.	Investigative	[62]
4-(2-(2-fluorobenzyloxy)phenyl)piperidine	DMCR3VM	Discovery agent	N.A.	Investigative	[62]
4-(2-(3-chlorophenoxy)phenyl)piperidine	DM0IT5E	Discovery agent	N.A.	Investigative	[62]
4-(2-(3-fluorophenoxy)-4-methylphenyl)piperidine	DMEPB9L	Discovery agent	N.A.	Investigative	[62]
4-(2-(3-fluorophenoxy)phenyl)piperidine	DMZMEOG	Discovery agent	N.A.	Investigative	[62]
4-(2-(4-fluorobenzyloxy)phenyl)piperidine	DM29QLG	Discovery agent	N.A.	Investigative	[62]
4-(2-(4-fluorophenoxy)-4-methylphenyl)piperidine	DMJNB8C	Discovery agent	N.A.	Investigative	[62]
4-(2-(4-fluorophenoxy)phenyl)piperidine	DMFQT9O	Discovery agent	N.A.	Investigative	[62]
4-(2-(benzyloxy)-3-fluorophenyl)piperidine	DMM2NHZ	Discovery agent	N.A.	Investigative	[62]
4-(2-(benzyloxy)-6-fluorophenyl)piperidine	DMF3S50	Discovery agent	N.A.	Investigative	[62]
4-(2-(benzyloxy)phenyl)piperidine	DMOC7PY	Discovery agent	N.A.	Investigative	[62]
4-(2-(phenoxymethyl)phenyl)piperidine	DM0OFRQ	Discovery agent	N.A.	Investigative	[62]
4-(2-fluoro-6-(2-fluorophenoxy)phenyl)piperidine	DMQUAP2	Discovery agent	N.A.	Investigative	[73]
4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine	DMUBHRF	Discovery agent	N.A.	Investigative	[62]
4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine	DMJ2GW0	Discovery agent	N.A.	Investigative	[62]
4-(2-fluoro-6-phenoxyphenyl)piperidine	DMXIGWC	Discovery agent	N.A.	Investigative	[62]
4-(2-phenoxyphenyl)piperidine	DMB5IFA	Discovery agent	N.A.	Investigative	[62]
4-(3-fluoro-2-phenoxyphenyl)piperidine	DM1C3NZ	Discovery agent	N.A.	Investigative	[62]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[83]
4-Allyl-6-nitro-2-piperazin-1-yl-quinoline	DM9WT8M	Discovery agent	N.A.	Investigative	[84]
4-Benzyl-6-nitro-2-piperazin-1-yl-quinoline	DMOBC0F	Discovery agent	N.A.	Investigative	[84]
4-Bromo-6-nitro-2-piperazin-1-yl-quinoline	DMH6OPI	Discovery agent	N.A.	Investigative	[84]
4-Chloro-6-nitro-2-piperazin-1-yl-quinoline	DM04OFE	Discovery agent	N.A.	Investigative	[84]
4-Furan-2-yl-6-nitro-2-piperazin-1-yl-quinoline	DMKT915	Discovery agent	N.A.	Investigative	[84]
4-Iodo-6-nitro-2-piperazin-1-yl-quinoline	DMC8D4R	Discovery agent	N.A.	Investigative	[84]
6,6-dimethyl-1-phenyl-3-aza-bicyclo[3.1.0]hexane	DMMZTE3	Discovery agent	N.A.	Investigative	[54]
6,8-Dinitro-2-piperazin-1-yl-quinoline	DME4193	Discovery agent	N.A.	Investigative	[74]
6-(3-aza-bicyclo[3.1.0]hexan-1-yl)quinoline	DMKFDQ7	Discovery agent	N.A.	Investigative	[54]
6-(piperidin-4-ylmethoxy)-2-naphthonitrile	DMBQKGY	Discovery agent	N.A.	Investigative	[50]
6-Bromo-2-piperazin-1-yl-quinoline	DMLT01H	Discovery agent	N.A.	Investigative	[74]
6-Chloro-2-piperazin-1-yl-quinoline	DMM41AQ	Discovery agent	N.A.	Investigative	[74]
6-Iodo-2-piperazin-1-yl-quinoline	DM31VLA	Discovery agent	N.A.	Investigative	[74]
6-Nitro-2-piperazin-1-yl-4-vinyl-quinoline	DMAOUQI	Discovery agent	N.A.	Investigative	[84]
6-Nitro-4-phenyl-2-piperazin-1-yl-quinoline	DMCEG6V	Discovery agent	N.A.	Investigative	[84]
7-(piperidin-4-ylmethoxy)-2-naphthonitrile	DM6I5K1	Discovery agent	N.A.	Investigative	[50]
8-Methyl-3-p-tolyl-8-aza-bicyclo[3.2.1]octane	DMOM4VS	Discovery agent	N.A.	Investigative	[79]
8R-hydroxylobel-9-ene	DML9HDA	Discovery agent	N.A.	Investigative	[85]
8R-hydroxylobelane	DMJ82TO	Discovery agent	N.A.	Investigative	[70]
8S-hydroxylobel-9-ene	DMRL3BK	Discovery agent	N.A.	Investigative	[70]
8S-hydroxylobelane	DMLONTS	Discovery agent	N.A.	Investigative	[70]
Beta-methoxyamphetamine	DMA9CSG	Discovery agent	N.A.	Investigative	[86]
Biphenyl-2-ylmethyl-(S)-pyrrolidin-3-yl-amine	DM4D7V6	Discovery agent	N.A.	Investigative	[87]
COCAINE.HCL	DMJRSIF	Discovery agent	N.A.	Investigative	[68]
CX-1001	DM7293Q	Solid tumour/cancer	2A00-2F9Z	Investigative	[20]
Cyclohexyl-(3,4-dichloro-phenyl)-acetonitrile	DMJEN45	Discovery agent	N.A.	Investigative	[88]
Cyclopentyl-(3,4-dichloro-phenyl)-acetonitrile	DMAKT65	Discovery agent	N.A.	Investigative	[88]
D-166A	DMQJD4P	Discovery agent	N.A.	Investigative	[89]
D-211A	DMIBOAK	Discovery agent	N.A.	Investigative	[89]
D-211B	DM54CKZ	Discovery agent	N.A.	Investigative	[89]
D-254C	DM6KFCO	Discovery agent	N.A.	Investigative	[89]
D-257A	DMN7E6Y	Discovery agent	N.A.	Investigative	[89]
D-257C	DM5GLJ2	Discovery agent	N.A.	Investigative	[89]
Difluorobenztropine	DM8ABD6	Discovery agent	N.A.	Investigative	[80]
Erythro-3,4-dichloromethylphenidate hydrochloride	DM8UVI3	Discovery agent	N.A.	Investigative	[68]
Isobutyl-(4-methyl-benzyl)-piperidin-4-yl-amine	DM293XH	Discovery agent	N.A.	Investigative	[90]
JNJ-28583867	DM5LEOR	Discovery agent	N.A.	Investigative	[91]
KF-A5	DMFBMYG	Discovery agent	N.A.	Investigative	[92]
KF-A6	DMQJ3T5	Discovery agent	N.A.	Investigative	[92]
MDL-28618	DMF76M8	Discovery agent	N.A.	Investigative	[49]
METHYLENEDIOXYAMPHETAMINE	DMP204G	Discovery agent	N.A.	Investigative	[66]
METHYLENEDIOXYMETHAMPHETAMINE	DMYVU47	Discovery agent	N.A.	Investigative	[93]
MMDA	DMUWVGP	Discovery agent	N.A.	Investigative	[94]
N*1*-(6-Nitro-quinolin-2-yl)-ethane-1,2-diamine	DME8KXT	Discovery agent	N.A.	Investigative	[74]
N,N-dimethyl(2-phenoxyphenyl)methanamine	DMWK91T	Discovery agent	N.A.	Investigative	[95]
N-(2-oxazolemethyl)milnacipran	DMVGP02	Discovery agent	N.A.	Investigative	[96]
N-(piperidin-4-yl)-N-propyl-2-naphthamide	DM9QIH4	Discovery agent	N.A.	Investigative	[57]
N-benzyl-N-isobutylpiperidin-4-amine	DM6QK7E	Discovery agent	N.A.	Investigative	[90]
N-cyclobutyl-N-(piperidin-4-yl)-2-naphthamide	DM1GTVW	Discovery agent	N.A.	Investigative	[57]
NISOXETINE	DMZBNH0	Discovery agent	N.A.	Investigative	[56]
norzotepine	DMS3N4X	Discovery agent	N.A.	Investigative	[97]
O-DESMETHYL TRAMADOL	DM8ZG2I	Discovery agent	N.A.	Investigative	[98]
Para-chloroamphetamine	DMOH75D	Discovery agent	N.A.	Investigative	[66]
PF-18298	DMJMU09	Discovery agent	N.A.	Investigative	[55]
PF-3409409	DMEZA0T	Attention deficit hyperactivity disorder	6A05.Z	Investigative	[99]
PF-526014	DMD8QOZ	Discovery agent	N.A.	Investigative	[55]
PYROVALERONE	DMV48S2	Discovery agent	N.A.	Investigative	[63]
QUIPAZINE	DMPY6IG	Discovery agent	N.A.	Investigative	[74]
R-226161	DM4BP7S	Discovery agent	N.A.	Investigative	[100]
R-NORDULOXETINE	DMGV4DS	Discovery agent	N.A.	Investigative	[59]
RTI-219	DM2QYXN	Discovery agent	N.A.	Investigative	[101]
S-34324	DMZLQ5W	Discovery agent	N.A.	Investigative	[102]
S33005	DM3Z6TI	Depression	6A70-6A7Z	Investigative	[42]
TEFLUDAZINE	DMRPFCS	Discovery agent	N.A.	Investigative	[103]
Threo-1-aza-5-phenyl[4.4.0]decane hydrochloride	DM4W1E8	Discovery agent	N.A.	Investigative	[68]
Threo-3,4-dichlororitalinol hydrochloride	DMA7GTH	N. A.	N. A.	Investigative	[68]
Trans-3-(o-tolyloxy)-2,3-dihydro-1H-inden-1-amine	DMEDC5I	Discovery agent	N.A.	Investigative	[104]
WIN-35065	DM6IH4F	Discovery agent	N.A.	Investigative	[101]
WIN-35066-2	DMOX1S0	N. A.	N. A.	Investigative	[105]
[3-(3,4-Dichloro-phenyl)-indan-1-yl]-methyl-amine	DM4BYEQ	Discovery agent	N.A.	Investigative	[64]
[3H]WIN35428	DMI8RU0	Discovery agent	N.A.	Investigative	[106]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Parkinson's disease	8A00.0	Substantia nigra tissue	8.76E-01	7.18E-05	6.19E-04
Major depressive disorder	6A20	Pre-frontal cortex	1.17E-01	0.07	0.59
Schizophrenia	6A20	Pre-frontal cortex	7.90E-01	0.04	0.14
Schizophrenia	6A20	Superior temporal cortex	4.98E-01	0.04	0.7

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Sodium-dependent serotonin transporter (SLC6A4) DTP Info
• Gene Name: SLC6A4

1 Preclinical Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Oxypertine	DMYKG8R	N. A.	N. A.	Preclinical	[107]

1 Investigative Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
SEROTONIN	DMOFCRY	Discovery agent	N.A.	Investigative	[108]

References

• [1] Psychopharmacological treatment of dermatological patients--when simply talking does not help. J Dtsch Dermatol Ges. 2007 Dec;5(12):1101-6.
• [2] Augmentation effect of combination therapy of aripiprazole and antidepressants on forced swimming test in mice. Psychopharmacology (Berl). 2009 Sep;206(1):97-107.
• [3] Pharmacotherapy for obesity. Drugs. 2005;65(10):1391-418.
• [4] Treatment of comorbid pain with serotonin norepinephrine reuptake inhibitors. CNS Spectr. 2008 Jul;13(7 Suppl 11):22-6.
• [5] Clinically relevant drug interactions with new generation antidepressants and antipsychotics. Ther Umsch. 2009 Jun;66(6):485-92.
• [6] Aminorex, fenfluramine, and chlorphentermine are serotonin transporter substrates.Implications for primary pulmonary hypertension.Circulation.1999 Aug 24;100(8):869-75.
• [7] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [8] Efficacy of treatments for patients with obsessive-compulsive disorder: a systematic review. J Am Acad Nurse Pract. 2009 Apr;21(4):207-13.
• [9] Differential involvement of the norepinephrine, serotonin and dopamine reuptake transporter proteins in cocaine-induced taste aversion. Pharmacol Biochem Behav. 2009 Jul;93(1):75-81.
• [10] Dasotraline for the Treatment of Attention-Deficit/Hyperactivity Disorder: A Randomized, Double-Blind, Placebo-Controlled, Proof-of-Concept Trial in Adults. Neuropsychopharmacology. 2015 Nov;40(12):2745-52.
• [11] 2008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6.
• [12] Multi-target therapeutics: when the whole is greater than the sum of the parts. Drug Discov Today. 2007 Jan;12(1-2):34-42.
• [13] Antidepressants and sleep: a review. Perspect Psychiatr Care. 2009 Jul;45(3):191-7.
• [14] Changes of functional MRI findings in a patient whose pathological gambling improved with fluvoxamine. Yonsei Med J. 2009 Jun 30;50(3):441-4.
• [15] Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
• [16] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [17] Emerging treatments for depression. Expert Opin Pharmacother. 2006 Dec;7(17):2323-39.
• [18] 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4.
• [19] Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651.
• [20] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 928).
• [21] Antitussives and substance abuse. Subst Abuse Rehabil. 2013 Nov 6;4:75-82.
• [22] Preclinical Evaluation of the Abuse Potential of the Analgesic Bicifadine
• [23] Clinical pipeline report, company report or official report of Intra-Cellular Therapies, Inc.
• [24] Litoxetine: a selective 5-HT uptake inhibitor with concomitant 5-HT3 receptor antagonist and antiemetic properties. Eur J Pharmacol. 1993 Mar 2;232(2-3):139-45.
• [25] Brasofensine NeuroSearch. Curr Opin Investig Drugs. 2000 Dec;1(4):504-7.
• [26] Clinical pipeline report, company report or official report of Clera Inc.
• [27] Effect of DA-8031, a novel oral compound for premature ejaculation, on male rat sexual behavior. Int J Urol. 2014 Mar;21(3):325-9.
• [28] Encyclopedia of Psychopharmacology. Ian Stolerman. 2010. Page(105).
• [29] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [30] Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92.
• [31] Preclinical to clinical translation of CNS transporter occupancy of TD-9855, a novel norepinephrine and serotonin reuptake inhibitor. Int J Neuropsychopharmacol. 2014 Dec 13;18(2). pii: pyu027.
• [32] Bifeprunox: a partial agonist at dopamine D2 and serotonin 1A receptors, influences nicotine-seeking behaviour in response to drug-associated stimuli in rats.Addict Biol.2012 Mar;17(2):274-86.
• [33] Company report (BioLineRx)
• [34] Monoamine transporter occupancy of a novel triple reuptake inhibitor in baboons and humans using positron emission tomography. J Pharmacol Exp Ther. 2013 Aug;346(2):311-7.
• [35] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028715)
• [36] Progress in the development of histamine H3 receptor antagonists/inverse agonists: a patent review (2013-2017).Expert Opin Ther Pat. 2018 Mar;28(3):175-196.
• [37] Serotonergic drugs : effects on appetite expression and use for the treatment of obesity. Drugs. 2007;67(1):27-55.
• [38] Nontricyclic antidepressant agents derived from cis- and trans-1-amino-4-aryltetralins. J Med Chem. 1984 Nov;27(11):1508-15.
• [39] Clinical pipeline report, company report or official report of Neurosearch.
• [40] Monoamine reuptake site occupancy of sibutramine: Relationship to antidepressant-like and thermogenic effects in rats.Eur J Pharmacol.2014 Aug 15;737:47-56.
• [41] Dopamine uptake inhibitor-induced rotation in 6-hydroxydopamine-lesioned rats involves both D1 and D2 receptors but is modulated through 5-hydroxyt... J Pharmacol Exp Ther. 2005 Mar;312(3):1124-31.
• [42] Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23.
• [43] NSD-644: Phase I started.NeuroSearch A/S (CSE:NEUR), Ballerup, Denmark, GlaxoSmithKline plc (LSE:GSK; GSK), London, U.K.
• [44] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031598)
• [45] Syntheses and binding affinities of 6-nitroquipazine analogues for serotonin transporter. Part 5: 2'-Substituted 6-nitroquipazines. Bioorg Med Chem. 2007 May 15;15(10):3499-504.
• [46] Structure-activity studies for a novel series of N-(arylethyl)-N-(1,2,3,4-tetrahydronaphthalen-1-ylmethyl)-N-methylamine s possessing dual 5-HT upt... J Med Chem. 1997 Mar 28;40(7):1049-62.
• [47] Antihypertensive activity in a series of 1-piperazino-3-phenylindans with potent 5-HT2-antagonistic activity. J Med Chem. 1988 Dec;31(12):2247-56.
• [48] Moxidectin causes adult worm mortality of human lymphatic filarial parasite Brugia malayi in rodent models. Folia Parasitol (Praha). 2014 Dec;61(6):561-70.
• [49] Synthesis and structure-activity relationships of selective norepinephrine reuptake inhibitors (sNRI) with a heterocyclic ring constraint. Bioorg Med Chem Lett. 2008 Aug 15;18(16):4495-8.
• [50] Design and optimization of selective serotonin re-uptake inhibitors with high synthetic accessibility. Part 1. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2329-32.
• [51] Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31.
• [52] New iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. Bioorg Med Chem Lett. 2008 Sep 15;18(18):4940-3.
• [53] Design and synthesis of (2R,3S)-iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. Bioorg Med Chem Lett. 2009 Sep 1;19(17):4996-8.
• [54] Studies on the structure-activity relationship of bicifadine analogs as monoamine transporter inhibitors. Bioorg Med Chem Lett. 2008 Jul 1;18(13):3682-6.
• [55] Second generation N-(1,2-diphenylethyl)piperazines as dual serotonin and noradrenaline reuptake inhibitors: improving metabolic stability and reduc... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3788-92.
• [56] 1-Naphthyl and 4-indolyl arylalkylamines as selective monoamine reuptake inhibitors. Bioorg Med Chem Lett. 2009 Jan 1;19(1):58-61.
• [57] Bioorg Med Chem Lett. 2009 Oct 15;19(20):5893-7. Epub 2009 Aug 21.Design and optimisation of selective serotonin re-uptake inhibitors with high synthetic accessibility: part 2.
• [58] Stereoselective inhibition of serotonin re-uptake and phosphodiesterase by dual inhibitors as potential agents for depression. Bioorg Med Chem. 2009 Jan 1;17(1):337-43.
• [59] Inhibition of serotonin and norepinephrine reuptake and inhibition of phosphodiesterase by multi-target inhibitors as potential agents for depression. Bioorg Med Chem. 2009 Oct 1;17(19):6890-7.
• [60] N-(1,2-diphenylethyl)piperazines: a new class of dual serotonin/noradrenaline reuptake inhibitor. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4345-8.
• [61] Structure-activity relationships of N-substituted piperazine amine reuptake inhibitors. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4349-53.
• [62] Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1... Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7.
• [63] 1-(4-Methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one (Pyrovalerone) analogues: a promising class of monoamine uptake inhibitors. J Med Chem. 2006 Feb 23;49(4):1420-32.
• [64] Synthesis and pharmacological evaluation of 3-(3,4-dichlorophenyl)-1-indanamine derivatives as nonselective ligands for biogenic amine transporters. J Med Chem. 2004 May 6;47(10):2624-34.
• [65] Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for cocaine addiction. J Med Chem. 2009 Nov 12;52(21):6768-81.
• [66] Synthesis and serotonin transporter activity of sulphur-substituted alpha-alkyl phenethylamines as a new class of anticancer agents. Eur J Med Chem. 2009 Dec;44(12):4862-88.
• [67] Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for smoking cessation. J Med Chem. 2010 Mar 11;53(5):2204-14.
• [68] Synthesis and pharmacology of site-specific cocaine abuse treatment agents: restricted rotation analogues of methylphenidate. J Med Chem. 2007 May 31;50(11):2718-31.
• [69] Synthesis, dopamine and serotonin transporter binding affinities of novel analogues of meperidine. Bioorg Med Chem Lett. 1999 Dec 6;9(23):3273-6.
• [70] Des-keto lobeline analogs with increased potency and selectivity at dopamine and serotonin transporters. Bioorg Med Chem Lett. 2006 Oct 1;16(19):5018-21.
• [71] Characterization of thien-2-yl 1S,2R-milnacipran analogues as potent norepinephrine/serotonin transporter inhibitors for the treatment of neuropath... J Med Chem. 2008 Nov 27;51(22):7265-72.
• [72] 2,5-Disubstituted tetrahydrofurans as selective serotonin re-uptake inhibitors. Bioorg Med Chem. 2009 Mar 1;17(5):2047-68.
• [73] Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agon... Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7.
• [74] Syntheses and binding affinities of 6-nitroquipazine analogues for serotonin transporter. Part 1. Bioorg Med Chem Lett. 2000 Jul 17;10(14):1559-62.
• [75] Synthesis and activity of novel 1- or 3-(3-amino-1-phenyl propyl)-1,3-dihydro-2H-benzimidazol-2-ones as selective norepinephrine reuptake inhibitors. Bioorg Med Chem Lett. 2008 Dec 1;18(23):6067-70.
• [76] Conformationally restricted homotryptamines. Part 4: Heterocyclic and naphthyl analogs of a potent selective serotonin reuptake inhibitor. Bioorg Med Chem Lett. 2007 Oct 15;17(20):5647-51.
• [77] Synthesis and monoamine transporter affinity of 3alpha-arylmethoxy-3beta-arylnortropanes. Bioorg Med Chem Lett. 2009 Dec 15;19(24):6865-8.
• [78] Conformationally restricted homotryptamines. Part 7: 3-cis-(3-aminocyclopentyl)indoles as potent selective serotonin reuptake inhibitors. J Med Chem. 2010 Nov 11;53(21):7564-72.
• [79] 3alpha-(4-Substituted phenyl)nortropane-2beta-carboxylic acid methyl esters show selective binding at the norepinephrine transporter. Bioorg Med Chem Lett. 2000 Nov 6;10(21):2445-7.
• [80] Structure-activity relationship studies on a novel series of (S)-2beta-substituted 3alpha-[bis(4-fluoro- or 4-chlorophenyl)methoxy]tropane analogue... J Med Chem. 2006 Oct 19;49(21):6391-9.
• [81] Conformationally restricted homotryptamines 3. Indole tetrahydropyridines and cyclohexenylamines as selective serotonin reuptake inhibitors. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3099-104.
• [82] Designing rapid onset selective serotonin re-uptake inhibitors. 2: structure-activity relationships of substituted (aryl)benzylamines. Bioorg Med Chem Lett. 2008 Jul 15;18(14):4018-21.
• [83] Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
• [84] Syntheses and binding affinities of 6-nitroquipazine analogues for serotonin transporter. Part 2: 4-substituted 6-nitroquipazines. Bioorg Med Chem Lett. 2002 Mar 11;12(5):811-5.
• [85] Lobeline esters as novel ligands for neuronal nicotinic acetylcholine receptors and neurotransmitter transporters. Bioorg Med Chem. 2010 Jan 15;18(2):640-9.
• [86] Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.
• [87] Derivatives of (3S)-N-(biphenyl-2-ylmethyl)pyrrolidin-3-amine as selective noradrenaline reuptake inhibitors: Reducing P-gp mediated efflux by modu... Bioorg Med Chem Lett. 2008 Aug 1;18(15):4355-9.
• [88] Synthesis and evaluation of dopamine and serotonin transporter inhibition by oxacyclic and carbacyclic analogues of methylphenidate. J Med Chem. 2003 Apr 10;46(8):1538-45.
• [89] Further structural optimization of cis-(6-benzhydryl-piperidin-3-yl)-benzylamine and 1,4-diazabicyclo[3.3.1]nonane derivatives by introducing an ex... Bioorg Med Chem. 2008 Mar 15;16(6):2769-78.
• [90] N-Alkyl-N-arylmethylpiperidin-4-amines: novel dual inhibitors of serotonin and norepinephrine reuptake. Bioorg Med Chem Lett. 2006 May 15;16(10):2714-8.
• [91] Synthesis and biological activity of piperazine and diazepane amides that are histamine H3 antagonists and serotonin reuptake inhibitors. Bioorg Med Chem Lett. 2008 Jan 1;18(1):39-43.
• [92] Design, synthesis, and evaluation of 10-N-substituted acridones as novel chemosensitizers in Plasmodium falciparum. Antimicrob Agents Chemother. 2007 Nov;51(11):4133-40.
• [93] The origin of MDMA (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5.
• [94] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [95] 1-(2-Phenoxyphenyl)methanamines: SAR for dual serotonin/noradrenaline reuptake inhibition, metabolic stability and hERG affinity. Bioorg Med Chem Lett. 2008 Jan 15;18(2):596-9.
• [96] Studies on the SAR and pharmacophore of milnacipran derivatives as monoamine transporter inhibitors. Bioorg Med Chem Lett. 2008 Feb 15;18(4):1346-9.
• [97] Norzotepine, a major metabolite of zotepine, exerts atypical antipsychotic-like and antidepressant-like actions through its potent inhibition of norepinephrine reuptake. J Pharmacol Exp Ther. 2010 Jun;333(3):772-81.
• [98] Derivatives of tramadol for increased duration of effect. Bioorg Med Chem Lett. 2006 Feb;16(3):691-4.
• [99] Design, synthesis and evaluation of N-[(3S)-pyrrolidin-3-yl]benzamides as selective noradrenaline reuptake inhibitors: CNS penetration in a more po... Bioorg Med Chem Lett. 2009 Aug 15;19(16):4579-83.
• [100] Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-a... Bioorg Med Chem. 2007 Jun 1;15(11):3649-60.
• [101] Synthesis, monoamine transporter binding, properties, and functional monoamine uptake activity of 3beta-[4-methylphenyl and 4-chlorophenyl]-2 beta-... J Med Chem. 2007 Jul 26;50(15):3686-95.
• [102] Discovery of a new series of centrally active tricyclic isoxazoles combining serotonin (5-HT) reuptake inhibition with alpha2-adrenoceptor blocking... J Med Chem. 2005 Mar 24;48(6):2054-71.
• [103] Neuroleptic activity and dopamine-uptake inhibition in 1-piperazino-3-phenylindans. J Med Chem. 1983 Jul;26(7):935-47.
• [104] Discovery of a potent, selective, and less flexible selective norepinephrine reuptake inhibitor (sNRI). Bioorg Med Chem Lett. 2008 Jul 15;18(14):4224-7.
• [105] Monoamine transporter binding, locomotor activity, and drug discrimination properties of 3-(4-substituted-phenyl)tropane-2-carboxylic acid methyl e... J Med Chem. 2004 Dec 2;47(25):6401-9.
• [106] 3 alpha-(4'-substituted phenyl)tropane-2 beta-carboxylic acid methyl esters: novel ligands with high affinity and selectivity at the dopamine trans... J Med Chem. 1996 Oct 11;39(21):4139-41.
• [107] Serotonin transporter gene and treatment of alcoholism.
• [108] Serotonin transporter gene, depressive symptoms, and interleukin-6. Circ Cardiovasc Genet. 2009 Dec;2(6):614-20.