General Information of Drug Therapeutic Target (DTT) (ID: TT3ROYC)

DTT Name Serotonin transporter (SERT)
Synonyms Solute carrier family 6 member 4; HTT; 5HTT; 5HT transporter
Gene Name SLC6A4
DTT Type
Successful target
[1]
BioChemical Class
Neurotransmitter:sodium symporter
UniProt ID
SC6A4_HUMAN
TTD ID
T27812
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
Function
Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner. Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization.
KEGG Pathway
Serotonergic synapse (hsa04726 )
Reactome Pathway
Serotonin clearance from the synaptic cleft (R-HSA-380615 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
26 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Acetaminophen DMUIE76 Allergic rhinitis CA08.0 Approved [2]
Amfepramone DM9YSNQ Migraine 8A80 Approved [3]
Amitriptyline DMK7F9S Depression 6A70-6A7Z Approved [4]
Bupropion DM5PCS7 Depression 6A70-6A7Z Approved [5]
Chlorphentermine Hydrochloride DMQRPOS Appetite suppressant MG43 Approved [6]
Citalopram DM2G9AE Acute coronary syndrome BA41 Approved [7]
Clomipramine DMINRKW Depression 6A70-6A7Z Approved [8]
Cocaine DMSOX7I Anaesthesia 9A78.6 Approved [9]
Dasotraline DMLDQFV Attention deficit hyperactivity disorder 6A05.Z Approved [10]
Desvenlafaxine DMHD4PE Major depressive disorder 6A70.3 Approved [11]
Dextromethorphan Polistirex DMEHCY5 Dry cough MD12 Approved [7]
Duloxetine DM9BI7M Depression 6A70-6A7Z Approved [12]
Escitalopram DMFK9HG Major depressive disorder 6A70.3 Approved [13]
Fluoxetine DM3PD2C Bipolar depression Approved [7]
Fluvoxamine DMQTJSX Depression 6A70-6A7Z Approved [14]
Levomilnacipran DMV26S8 Fibromyalgia MG30.01 Approved [15]
Luvox DMJKROX Anxiety disorder 6B00-6B0Z Approved [16]
Nortriptyline DM4KDYJ Depression 6A70-6A7Z Approved [7]
Paroxetine DM5PVQE Anxiety disorder 6B00-6B0Z Approved [7]
Sertraline DM0FB1J Coronary heart disease BA80.Z Approved [1]
Sibutramine DMFJTDI Obesity 5B81 Approved [7]
Tianeptine DMYN8MA Major depressive disorder 6A70.3 Approved [17]
Trazodone DMK1GBJ Depression 6A70-6A7Z Approved [7]
Venlafaxine DMR6QH0 Anxiety disorder 6B00-6B0Z Approved [5]
Vilazodone DM4LECQ Major depressive disorder 6A70.3 Approved [18]
Vortioxetine DM6F1PU Major depressive disorder 6A70.3 Approved [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 26 Approved Drug(s)
17 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Amitifadine DMS1X67 Obesity 5B81 Phase 3 [20]
AVP-786 DMV1SOR Alzheimer disease 8A20 Phase 3 [21]
Bicifadine DM42GP9 Chronic low back pain MG30.02 Phase 3 [22]
ITI-007 DMUQ1DO Depression 6A70-6A7Z Phase 3 [23]
LITOXETINE DMKZRBP Mood disorder 6A60-6E23 Phase 3 [24]
Brasofensine DM3TRF7 Parkinson disease 8A00.0 Phase 2 [25]
CLR-3001 DM3Z6IQ Major depressive disorder 6A70.3 Phase 2 [26]
DA-8031 DMP6MH9 Premature ejaculation HA03.0Z Phase 2 [27]
Lu-AA34893 DM2ZUXK Anxiety disorder 6B00-6B0Z Phase 2 [28]
MIN-117 DMSLIW6 Major depressive disorder 6A70.3 Phase 2 [29]
NS 2359 DMI5HFU Cocaine addiction 6C45.2 Phase 2 [30]
TD-9855 DMQD5NA Pain MG30-MG3Z Phase 2 [31]
AD-337 DM8VQ1S Chemotherapy-induced nausea MD90 Phase 1 [16]
BGC-20-1259 DMED4AJ Parkinson disease 8A00.0 Phase 1 [32]
BL-1021 DMAYSFK Pain MG30-MG3Z Phase 1 [33]
GSK-1360707 DMZC9XU Major depressive disorder 6A70.3 Phase 1 [34]
SEP-228432 DMF89ZT Depression 6A70-6A7Z Phase 1 [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Clinical Trial Drug(s)
3 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Citalopram derivative 1 DMITX1G N. A. N. A. Patented [36]
Piperidine derivative 1 DMHN5KW N. A. N. A. Patented [36]
PMID29334795-Compound-61 DM9H3LI N. A. N. A. Patented [36]
------------------------------------------------------------------------------------
15 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dexfenfluramine DMJ7YDS Obesity 5B81 Withdrawn from market [37]
ZIMELIDINE DMNI3U2 Depression 6A70-6A7Z Withdrawn from market [38]
DOV-216303 DMTE14H Mood disorder 6A60-6E23 Discontinued in Phase 2 [30]
NS-2389 DMVRJ8D Major depressive disorder 6A70.3 Discontinued in Phase 2 [39]
OxycoDex DMHFOIX Pain MG30-MG3Z Discontinued in Phase 2 [21]
R-sibutramine metabolite DMPAH74 Attention deficit hyperactivity disorder 6A05.Z Discontinued in Phase 2 [40]
SPD-473 DMTJNRL Mood disorder 6A60-6E23 Discontinued in Phase 2 [41]
YM-992 DM845NM Depression 6A70-6A7Z Discontinued in Phase 2 [42]
NSD-644 DMNL9DS Neurological disorder 6B60 Discontinued in Phase 1 [43]
RG-7166 DMKLPMW Major depressive disorder 6A70.3 Discontinued in Phase 1 [44]
6-nitroquipazine DM5MVF9 N. A. N. A. Terminated [45]
A-80426 DMBC3DG N. A. N. A. Terminated [46]
HydrocoDex DM4HA9C Pain MG30-MG3Z Terminated [21]
Irindalone DMJ3ZUN Inflammation 1A00-CA43.1 Terminated [47]
MOXIFETIN HYDROGEN MALEATE DMO2S6T Mood disorder 6A60-6E23 Terminated [48]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Discontinued Drug(s)
232 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
((3R,4R)-4-(o-tolyloxy)chroman-3-yl)methanamine DM2TIU3 Discovery agent N.A. Investigative [49]
(+/-)-3-((naphthalen-2-yloxy)methyl)pyrrolidine DML68KX Discovery agent N.A. Investigative [50]
(+/-)-nantenine DM0L3GE Discovery agent N.A. Investigative [51]
(2R,3R)-iodoreboxetine DMYRHFI Discovery agent N.A. Investigative [52]
(2R,3S)-2-[(2-Iodophenoxy)phenylmethyl]morpholine DMY2FX8 Discovery agent N.A. Investigative [53]
(2R,3S)-2-[(3-Iodophenoxy)phenylmethyl]morpholine DM260TI Discovery agent N.A. Investigative [53]
(2R,3S)-2-[(4-Iodophenoxy)phenylmethyl]morpholine DMKM8E2 Discovery agent N.A. Investigative [53]
(2S,3S)-iodoreboxetine DMBEOIQ Discovery agent N.A. Investigative [52]
(cis)-1,6-diphenyl-3-aza-bicyclo[3.1.0]hexane DMMC139 Discovery agent N.A. Investigative [54]
(R)-2-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol DM74IWX Discovery agent N.A. Investigative [55]
(R)-3-(naphthalen-2-ylmethoxy)pyrrolidine DM94B12 Discovery agent N.A. Investigative [50]
(R)-6-(pyrrolidin-3-ylmethoxy)-2-naphthonitrile DM134UV Discovery agent N.A. Investigative [50]
(R)-DULOXETINE DMECK7H Discovery agent N.A. Investigative [56]
(R)-N-isobutyl-N-(pyrrolidin-3-yl)-2-naphthamide DMJFH97 Discovery agent N.A. Investigative [57]
(R)-N-isopropyl-N-(pyrrolidin-3-yl)-2-naphthamide DMQIUOB Discovery agent N.A. Investigative [57]
(R)-Norfluoxetine DMS30KU Discovery agent N.A. Investigative [58]
(S)-3-(naphthalen-2-ylmethoxy)pyrrolidine DM5ILK1 Discovery agent N.A. Investigative [50]
(S)-6-(pyrrolidin-3-ylmethoxy)-2-naphthonitrile DM32PJ5 Discovery agent N.A. Investigative [50]
(S)-N-isobutyl-N-(pyrrolidin-3-yl)-2-naphthamide DMUAYZJ Discovery agent N.A. Investigative [57]
(S)-NORDULOXETINE DMULFYA Discovery agent N.A. Investigative [59]
(S)-Norfluoxetine DM8ZTPF Discovery agent N.A. Investigative [58]
1-(1,2-diphenylethyl)piperazine DM0ARKB Discovery agent N.A. Investigative [60]
1-(1,3-diphenylpropyl)piperazine DMTC98X Discovery agent N.A. Investigative [61]
1-(1,4-diphenylbutan-2-yl)piperazine DM8Z1QU Discovery agent N.A. Investigative [61]
1-(1-(2-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX) DMCSOAV Discovery agent N.A. Investigative [55]
1-(1-(4-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX) DMS9PZ7 Discovery agent N.A. Investigative [55]
1-(1-phenyl-2-(2-propoxyphenyl)ethyl)piperazine DM54ZKU Discovery agent N.A. Investigative [55]
1-(1-phenyl-2-(pyridin-2-yl)ethyl)piperazine DMIZBP6 Discovery agent N.A. Investigative [61]
1-(1-phenyl-2-(pyridin-4-yl)ethyl)piperazine DMTVPZC Discovery agent N.A. Investigative [61]
1-(1-phenyl-2-o-tolylethyl)piperazine DMZ6QX0 Discovery agent N.A. Investigative [60]
1-(2-((3-fluorophenoxy)methyl)phenyl)piperazine DMJXKOF Discovery agent N.A. Investigative [62]
1-(2-(2-(DIFLUOROMETHOXY)PHENYL)-1-PHENYLETHYL)PIPERAZINE (ENANTIOMERIC MIX) DMUJ2WB Discovery agent N.A. Investigative [55]
1-(2-(2-bromophenyl)-1-phenylethyl)piperazine DMPRALC Discovery agent N.A. Investigative [60]
1-(2-(2-chlorophenyl)-1-phenylethyl)piperazine DMUM4YQ Discovery agent N.A. Investigative [60]
1-(2-(2-ethoxyphenyl)-1-phenylethyl)piperazine DMBRS3D Discovery agent N.A. Investigative [60]
1-(2-(2-ethylphenyl)-1-phenylethyl)piperazine DMKWRCD Discovery agent N.A. Investigative [60]
1-(2-(2-fluorobenzyloxy)phenyl)piperazine DM6XCPV Discovery agent N.A. Investigative [62]
1-(2-(2-methoxyphenyl)-1-phenylethyl)piperazine DM2H38V Discovery agent N.A. Investigative [55]
1-(2-(3-chlorophenyl)-1-phenylethyl)piperazine DM4WEGM Discovery agent N.A. Investigative [60]
1-(2-(3-fluorophenoxy)phenyl)piperazine DMXV2KQ Discovery agent N.A. Investigative [62]
1-(2-(3-methoxyphenyl)-1-phenylethyl)piperazine DM8V5IH Discovery agent N.A. Investigative [60]
1-(2-(4-fluorophenoxy)phenyl)piperazine DMU082P Discovery agent N.A. Investigative [62]
1-(2-(6-fluoronaphthalen-2-yl)ethyl)piperazine DMR4DJ1 Discovery agent N.A. Investigative [50]
1-(2-(benzyloxy)phenyl)piperazine DM0UZHL Discovery agent N.A. Investigative [62]
1-(2-(naphthalen-1-yl)-1-phenylethyl)piperazine DMXL7Z5 Discovery agent N.A. Investigative [61]
1-(2-(naphthalen-2-yl)-1-phenylethyl)piperazine DMTEBP0 Discovery agent N.A. Investigative [61]
1-(2-(naphthalen-2-yl)ethyl)piperazine DMS7YF6 Discovery agent N.A. Investigative [50]
1-(2-(phenoxymethyl)phenyl)piperazine DM7Z19T Discovery agent N.A. Investigative [62]
1-(2-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one DMBWCOZ Discovery agent N.A. Investigative [63]
1-(2-phenoxyphenyl)piperazine DMWFCYN Discovery agent N.A. Investigative [62]
1-(3,4-Dichloro-phenyl)-3-diethylamino-indan-5-ol DMN4JU0 Discovery agent N.A. Investigative [64]
1-(3,4-Dichloro-phenyl)-3-methylamino-indan-5-ol DMWIEDN Discovery agent N.A. Investigative [64]
1-(3-chlorophenyl)-2-(piperidin-1-yl)propan-1-one DMPOVUY Discovery agent N.A. Investigative [65]
1-(3-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one DMPEZ1V Discovery agent N.A. Investigative [63]
1-(3-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one DMB9T6F Discovery agent N.A. Investigative [63]
1-(4-Benzylsulfanyl-phenyl)-propylamine DMXV9S7 Discovery agent N.A. Investigative [66]
1-(4-bromophenyl)-2-(tert-butylamino)propan-1-one DMW6YDK Discovery agent N.A. Investigative [67]
1-(4-bromophenyl)-2-pyrrolidin-1-yl-pentan-1-one DMPLEC0 Discovery agent N.A. Investigative [63]
1-(4-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one DMBV8PT Discovery agent N.A. Investigative [63]
1-(4-nitrophenyl)-2-pyrrolidin-1-yl-pentan-1-one DME435S Discovery agent N.A. Investigative [63]
1-(benzofuran-2-yl)-3-aza-bicyclo[3.1.0]hexane DMGNL2A Discovery agent N.A. Investigative [54]
1-(naphthalen-2-yl)-3-aza-bicyclo[3.1.0]hexane DMUEQC8 Discovery agent N.A. Investigative [54]
1-(thiophen-2-yl)-3-aza-bicyclo[3.1.0]hexane DM6J1AK Discovery agent N.A. Investigative [54]
1-benzylpiperidine hydrochloride DM7GDEK Discovery agent N.A. Investigative [68]
1-Biphenyl-4-yl-3-aza-bicyclo[3.1.0]hexane DM6E7TA Discovery agent N.A. Investigative [54]
1-fluoro-5-phenyl-3-aza-bicyclo[3.1.0]hexane DM0Q46C Discovery agent N.A. Investigative [54]
1-Methyl-2-(4-phenylsulfanyl-phenyl)-ethylamine DMYU348 Discovery agent N.A. Investigative [66]
1-Methyl-4-p-tolyl-piperidine-4-carbonitrile DM6XFMT Discovery agent N.A. Investigative [69]
1-naphthalen-2-yl-2-pyrrolidin-1-yl-pentan-1-one DMU04ZQ Discovery agent N.A. Investigative [63]
1-phenyl-3-aza-bicyclo[3.1.0]hexane DMUA72F Discovery agent N.A. Investigative [54]
10R-hydroxylobel-7-ene DM8XRCT Discovery agent N.A. Investigative [70]
10R-hydroxylobelane DMN93QT Discovery agent N.A. Investigative [70]
10S-hydroxylobel-7-ene DMN1YQ6 Discovery agent N.A. Investigative [70]
10S-hydroxylobelane DM54AKV Discovery agent N.A. Investigative [70]
1S,2R-milnacipran DM7Y5AN Discovery agent N.A. Investigative [71]
2-(2'-Aminoethyl)-5-benzyltetrahydrofuran DMVTD1F Discovery agent N.A. Investigative [72]
2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine DM1ULEX Discovery agent N.A. Investigative [73]
2-(2-fluorophenoxy)-3-(piperidin-4-yl)pyridine DM1SN37 Discovery agent N.A. Investigative [73]
2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine DMYVDJQ Discovery agent N.A. Investigative [73]
2-(2-phenyl-2-(piperazin-1-yl)ethyl)benzonitrile DMO9SP1 Discovery agent N.A. Investigative [60]
2-(3-Methyl-piperazin-1-yl)-6-nitro-quinoline DM1J4MT Discovery agent N.A. Investigative [74]
2-(Aminomethyl)-5-(1'-naphthethyl)tetrahydrofuran DMU4MIC Discovery agent N.A. Investigative [72]
2-(Aminomethyl)-5-(1'-naphthyl)tetrahydrofuran DMCUTY9 Discovery agent N.A. Investigative [72]
2-(Aminomethyl)-5-(2'-naphthyl)tetrahydrofuran DM157SO Discovery agent N.A. Investigative [72]
2-(Aminomethyl)-5-phenethyltetrahydrofuran DMEZ7O2 Discovery agent N.A. Investigative [72]
2-(N-Cyclopentylamino)-3'-methoxypropiophenone DMVN1UI Discovery agent N.A. Investigative [67]
2-(N-Cyclopropylamino)-3-chloropropiophenone DMNMES3 Discovery agent N.A. Investigative [65]
2-(N-tert-Butylamino)-3',4'-dichloropropiophenone DMKIEVP Discovery agent N.A. Investigative [65]
2-(tert-butylamino)-1-(3-chlorophenyl)butan-1-one DMI457Y Discovery agent N.A. Investigative [67]
2-(tert-Butylamino)-3',4'-dichlorobutyrophenone DMOJK8Y Discovery agent N.A. Investigative [65]
2-(tert-Butylamino)-3',4'-dichloropentanophenone DMMUDQ7 Discovery agent N.A. Investigative [65]
2-Amino-1-(4-ethylthiophenyl)butane DM73FWA Discovery agent N.A. Investigative [66]
2-Amino-1-(4-ethylthiophenyl)propane DMS5LKR Discovery agent N.A. Investigative [66]
2-Amino-1-(4-methylthiophenyl)butane DMW7N3H Discovery agent N.A. Investigative [66]
2-Amino-1-(4-methylthiophenyl)propane DMJ2Z9G Discovery agent N.A. Investigative [66]
2-Aminomethyl-5-(p-bromophenyl)tetrahydrofuran DMCJUWK Discovery agent N.A. Investigative [72]
2-Aminomethyl-5-(p-chlorophenyl)tetrahydrofuran DM3OTZY Discovery agent N.A. Investigative [72]
2-Aminomethyl-5-(p-methoxyphenyl)tetrahydrofuran DMDG8FL Discovery agent N.A. Investigative [72]
2-Aminomethyl-5-(p-t-butylphenyl)tetrahydrofuran DME4P7K Discovery agent N.A. Investigative [72]
2-Aminomethyl-5-(phenyl)tetrahydrofuran DM413ZB Discovery agent N.A. Investigative [72]
2-N,N-Dimethylamino-1-(4-methylthiophenyl)propane DMKSUVH Discovery agent N.A. Investigative [66]
2-N-(Isopropyl)amino-1-(4-methylthiophenyl)butane DM0PT8R Discovery agent N.A. Investigative [66]
2-N-(n-Propyl)amino-1-(4-methylthiophenyl)butane DMLJ30O Discovery agent N.A. Investigative [66]
2-N-Allylamino-1-(4-methylthiophenyl)propan DM5S0BY Discovery agent N.A. Investigative [66]
2-N-Cyclopropylamino-1-(4-methylthiophenyl)butane DMS0NW3 Discovery agent N.A. Investigative [66]
2-N-Ethylamino-1-(4-ethylthiophenyl)butane DMCYVS0 Discovery agent N.A. Investigative [66]
2-N-Ethylamino-1-(4-ethylthiophenyl)propane DM64093 Discovery agent N.A. Investigative [66]
2-N-Ethylamino-1-(4-methylthiophenyl)butane DMKA3V2 Discovery agent N.A. Investigative [66]
2-N-Ethylamino-1-(4-methylthiophenyl)propane DM6O1SY Discovery agent N.A. Investigative [66]
2-N-Hydroxyamino-1-(4-ethylthiophenyl)butane DM2MH6J Discovery agent N.A. Investigative [66]
2-N-Hydroxyamino-1-(4-ethylthiophenyl)propane DMIQGWK Discovery agent N.A. Investigative [66]
2-N-Hydroxyamino-1-(4-methylthiophenyl)butane DME41NR Discovery agent N.A. Investigative [66]
2-N-Hydroxyamino-1-(4-methylthiophenyl)propane DMZDYCW Discovery agent N.A. Investigative [66]
2-N-Methoxyamino-1-(4-methylthiophenyl)propane DMHCVKJ Discovery agent N.A. Investigative [66]
2-N-Methylamino-1-(4-ethylthiophenyl)propane DM1X5RY Discovery agent N.A. Investigative [66]
2-N-Methylamino-1-(4-methylthiophenyl)butane DMCR49K Discovery agent N.A. Investigative [66]
2-N-Methylamino-1-(4-methylthiophenyl)propane DMVLX1T Discovery agent N.A. Investigative [66]
2-N-Propargylamino-1-(4-methylthiophenyl)butane DMLZCOU Discovery agent N.A. Investigative [66]
2-N-Propargylamino-1-(4-methylthiophenyl)propane DM9HPG1 Discovery agent N.A. Investigative [66]
2-Naphthalen-2-ylmethyl-4,5-dihydro-1H-imidazole DMNMEPB Discovery agent N.A. Investigative [46]
2-phenoxy-3-(piperidin-4-yl)pyridine DM6JNT5 Discovery agent N.A. Investigative [73]
2-[1,4]Diazepan-1-yl-6-nitro-quinoline DMEA2SR Discovery agent N.A. Investigative [74]
3-(1H-indol-1-yl)-N-methyl-3-phenylpropan-1-amine DMLV80B Discovery agent N.A. Investigative [75]
3-(1H-indol-3-yl)-N,N-dimethylpropan-1-amine DM6Y2XK Discovery agent N.A. Investigative [76]
3-(2-phenyl-2-(piperazin-1-yl)ethyl)benzamide DM0YEGM Discovery agent N.A. Investigative [60]
3-(2-phenyl-2-(piperazin-1-yl)ethyl)benzonitrile DM6YJOU Discovery agent N.A. Investigative [60]
3-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol DM6QZTB Discovery agent N.A. Investigative [60]
3-(3,4-dichlorophenyl)-2-nortropene DMT3AW8 Discovery agent N.A. Investigative [77]
3-(3-aminocyclopentyl)-1H-indole-5-carbonitrile DMB6SP8 Discovery agent N.A. Investigative [78]
3-(4-Chlorophenyl)-2-nortropene DM71EUO Discovery agent N.A. Investigative [77]
3-(4-Fluorophenyl)-2-nortropene DM8CK9M Discovery agent N.A. Investigative [77]
3-(4-Trifluoromethylphenyl)-2-nortropene DMZB804 Discovery agent N.A. Investigative [77]
3-(piperidin-4-yl)-2-(o-tolyloxy)pyridine DM2ETXB Discovery agent N.A. Investigative [73]
3-alpha-Phenylmethoxy-3-beta-phenyl-nortropane DMO5IJA Discovery agent N.A. Investigative [77]
3-Bromo-6-nitro-2-piperazin-1-yl-quinoline DMXZB5C Discovery agent N.A. Investigative [74]
3-p-Tolyl-8-aza-bicyclo[3.2.1]octane DM0872E Discovery agent N.A. Investigative [79]
3-Phenyl-2-nortropene DMAJMU6 Discovery agent N.A. Investigative [77]
3alpha-(bis-chloro-phenylmethoxy)tropane DMBUZWQ Discovery agent N.A. Investigative [80]
4-((naphthalen-2-yloxy)methyl)piperidine DMIQHYZ Discovery agent N.A. Investigative [50]
4-(1H-indol-3-yl)-N,N-dimethylcyclohex-3-enamine DM7Y1ZD Discovery agent N.A. Investigative [81]
4-(2-((3-fluorophenoxy)methyl)phenyl)piperidine DMJ9CNA Discovery agent N.A. Investigative [62]
4-(2-((dimethylamino)methyl)phenoxy)benzonitrile DM0MWVU Discovery agent N.A. Investigative [82]
4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine DM9UA0N Discovery agent N.A. Investigative [62]
4-(2-(2-fluorobenzyloxy)phenyl)piperidine DMCR3VM Discovery agent N.A. Investigative [62]
4-(2-(3-chlorophenoxy)phenyl)piperidine DM0IT5E Discovery agent N.A. Investigative [62]
4-(2-(3-fluorophenoxy)-4-methylphenyl)piperidine DMEPB9L Discovery agent N.A. Investigative [62]
4-(2-(3-fluorophenoxy)phenyl)piperidine DMZMEOG Discovery agent N.A. Investigative [62]
4-(2-(4-fluorobenzyloxy)phenyl)piperidine DM29QLG Discovery agent N.A. Investigative [62]
4-(2-(4-fluorophenoxy)-4-methylphenyl)piperidine DMJNB8C Discovery agent N.A. Investigative [62]
4-(2-(4-fluorophenoxy)phenyl)piperidine DMFQT9O Discovery agent N.A. Investigative [62]
4-(2-(benzyloxy)-3-fluorophenyl)piperidine DMM2NHZ Discovery agent N.A. Investigative [62]
4-(2-(benzyloxy)-6-fluorophenyl)piperidine DMF3S50 Discovery agent N.A. Investigative [62]
4-(2-(benzyloxy)phenyl)piperidine DMOC7PY Discovery agent N.A. Investigative [62]
4-(2-(phenoxymethyl)phenyl)piperidine DM0OFRQ Discovery agent N.A. Investigative [62]
4-(2-fluoro-6-(2-fluorophenoxy)phenyl)piperidine DMQUAP2 Discovery agent N.A. Investigative [73]
4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine DMUBHRF Discovery agent N.A. Investigative [62]
4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine DMJ2GW0 Discovery agent N.A. Investigative [62]
4-(2-fluoro-6-phenoxyphenyl)piperidine DMXIGWC Discovery agent N.A. Investigative [62]
4-(2-phenoxyphenyl)piperidine DMB5IFA Discovery agent N.A. Investigative [62]
4-(3-fluoro-2-phenoxyphenyl)piperidine DM1C3NZ Discovery agent N.A. Investigative [62]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one DMM9X0G Discovery agent N.A. Investigative [83]
4-Allyl-6-nitro-2-piperazin-1-yl-quinoline DM9WT8M Discovery agent N.A. Investigative [84]
4-Benzyl-6-nitro-2-piperazin-1-yl-quinoline DMOBC0F Discovery agent N.A. Investigative [84]
4-Bromo-6-nitro-2-piperazin-1-yl-quinoline DMH6OPI Discovery agent N.A. Investigative [84]
4-Chloro-6-nitro-2-piperazin-1-yl-quinoline DM04OFE Discovery agent N.A. Investigative [84]
4-Furan-2-yl-6-nitro-2-piperazin-1-yl-quinoline DMKT915 Discovery agent N.A. Investigative [84]
4-Iodo-6-nitro-2-piperazin-1-yl-quinoline DMC8D4R Discovery agent N.A. Investigative [84]
6,6-dimethyl-1-phenyl-3-aza-bicyclo[3.1.0]hexane DMMZTE3 Discovery agent N.A. Investigative [54]
6,8-Dinitro-2-piperazin-1-yl-quinoline DME4193 Discovery agent N.A. Investigative [74]
6-(3-aza-bicyclo[3.1.0]hexan-1-yl)quinoline DMKFDQ7 Discovery agent N.A. Investigative [54]
6-(piperidin-4-ylmethoxy)-2-naphthonitrile DMBQKGY Discovery agent N.A. Investigative [50]
6-Bromo-2-piperazin-1-yl-quinoline DMLT01H Discovery agent N.A. Investigative [74]
6-Chloro-2-piperazin-1-yl-quinoline DMM41AQ Discovery agent N.A. Investigative [74]
6-Iodo-2-piperazin-1-yl-quinoline DM31VLA Discovery agent N.A. Investigative [74]
6-Nitro-2-piperazin-1-yl-4-vinyl-quinoline DMAOUQI Discovery agent N.A. Investigative [84]
6-Nitro-4-phenyl-2-piperazin-1-yl-quinoline DMCEG6V Discovery agent N.A. Investigative [84]
7-(piperidin-4-ylmethoxy)-2-naphthonitrile DM6I5K1 Discovery agent N.A. Investigative [50]
8-Methyl-3-p-tolyl-8-aza-bicyclo[3.2.1]octane DMOM4VS Discovery agent N.A. Investigative [79]
8R-hydroxylobel-9-ene DML9HDA Discovery agent N.A. Investigative [85]
8R-hydroxylobelane DMJ82TO Discovery agent N.A. Investigative [70]
8S-hydroxylobel-9-ene DMRL3BK Discovery agent N.A. Investigative [70]
8S-hydroxylobelane DMLONTS Discovery agent N.A. Investigative [70]
Beta-methoxyamphetamine DMA9CSG Discovery agent N.A. Investigative [86]
Biphenyl-2-ylmethyl-(S)-pyrrolidin-3-yl-amine DM4D7V6 Discovery agent N.A. Investigative [87]
COCAINE.HCL DMJRSIF Discovery agent N.A. Investigative [68]
CX-1001 DM7293Q Solid tumour/cancer 2A00-2F9Z Investigative [20]
Cyclohexyl-(3,4-dichloro-phenyl)-acetonitrile DMJEN45 Discovery agent N.A. Investigative [88]
Cyclopentyl-(3,4-dichloro-phenyl)-acetonitrile DMAKT65 Discovery agent N.A. Investigative [88]
D-166A DMQJD4P Discovery agent N.A. Investigative [89]
D-211A DMIBOAK Discovery agent N.A. Investigative [89]
D-211B DM54CKZ Discovery agent N.A. Investigative [89]
D-254C DM6KFCO Discovery agent N.A. Investigative [89]
D-257A DMN7E6Y Discovery agent N.A. Investigative [89]
D-257C DM5GLJ2 Discovery agent N.A. Investigative [89]
Difluorobenztropine DM8ABD6 Discovery agent N.A. Investigative [80]
Erythro-3,4-dichloromethylphenidate hydrochloride DM8UVI3 Discovery agent N.A. Investigative [68]
Isobutyl-(4-methyl-benzyl)-piperidin-4-yl-amine DM293XH Discovery agent N.A. Investigative [90]
JNJ-28583867 DM5LEOR Discovery agent N.A. Investigative [91]
KF-A5 DMFBMYG Discovery agent N.A. Investigative [92]
KF-A6 DMQJ3T5 Discovery agent N.A. Investigative [92]
MDL-28618 DMF76M8 Discovery agent N.A. Investigative [49]
METHYLENEDIOXYAMPHETAMINE DMP204G Discovery agent N.A. Investigative [66]
METHYLENEDIOXYMETHAMPHETAMINE DMYVU47 Discovery agent N.A. Investigative [93]
MMDA DMUWVGP Discovery agent N.A. Investigative [94]
N*1*-(6-Nitro-quinolin-2-yl)-ethane-1,2-diamine DME8KXT Discovery agent N.A. Investigative [74]
N,N-dimethyl(2-phenoxyphenyl)methanamine DMWK91T Discovery agent N.A. Investigative [95]
N-(2-oxazolemethyl)milnacipran DMVGP02 Discovery agent N.A. Investigative [96]
N-(piperidin-4-yl)-N-propyl-2-naphthamide DM9QIH4 Discovery agent N.A. Investigative [57]
N-benzyl-N-isobutylpiperidin-4-amine DM6QK7E Discovery agent N.A. Investigative [90]
N-cyclobutyl-N-(piperidin-4-yl)-2-naphthamide DM1GTVW Discovery agent N.A. Investigative [57]
NISOXETINE DMZBNH0 Discovery agent N.A. Investigative [56]
norzotepine DMS3N4X Discovery agent N.A. Investigative [97]
O-DESMETHYL TRAMADOL DM8ZG2I Discovery agent N.A. Investigative [98]
Para-chloroamphetamine DMOH75D Discovery agent N.A. Investigative [66]
PF-18298 DMJMU09 Discovery agent N.A. Investigative [55]
PF-3409409 DMEZA0T Attention deficit hyperactivity disorder 6A05.Z Investigative [99]
PF-526014 DMD8QOZ Discovery agent N.A. Investigative [55]
PYROVALERONE DMV48S2 Discovery agent N.A. Investigative [63]
QUIPAZINE DMPY6IG Discovery agent N.A. Investigative [74]
R-226161 DM4BP7S Discovery agent N.A. Investigative [100]
R-NORDULOXETINE DMGV4DS Discovery agent N.A. Investigative [59]
RTI-219 DM2QYXN Discovery agent N.A. Investigative [101]
S-34324 DMZLQ5W Discovery agent N.A. Investigative [102]
S33005 DM3Z6TI Depression 6A70-6A7Z Investigative [42]
TEFLUDAZINE DMRPFCS Discovery agent N.A. Investigative [103]
Threo-1-aza-5-phenyl[4.4.0]decane hydrochloride DM4W1E8 Discovery agent N.A. Investigative [68]
Threo-3,4-dichlororitalinol hydrochloride DMA7GTH N. A. N. A. Investigative [68]
Trans-3-(o-tolyloxy)-2,3-dihydro-1H-inden-1-amine DMEDC5I Discovery agent N.A. Investigative [104]
WIN-35065 DM6IH4F Discovery agent N.A. Investigative [101]
WIN-35066-2 DMOX1S0 N. A. N. A. Investigative [105]
[3-(3,4-Dichloro-phenyl)-indan-1-yl]-methyl-amine DM4BYEQ Discovery agent N.A. Investigative [64]
[3H]WIN35428 DMI8RU0 Discovery agent N.A. Investigative [106]
------------------------------------------------------------------------------------
⏷ Show the Full List of 232 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Parkinson's disease 8A00.0 Substantia nigra tissue 8.76E-01 7.18E-05 6.19E-04
Major depressive disorder 6A20 Pre-frontal cortex 1.17E-01 0.07 0.59
Schizophrenia 6A20 Pre-frontal cortex 7.90E-01 0.04 0.14
Schizophrenia 6A20 Superior temporal cortex 4.98E-01 0.04 0.7
------------------------------------------------------------------------------------

The Drug Transporter (DTP) Role of This DTT

DTT DTP Name Sodium-dependent serotonin transporter (SLC6A4) DTP Info
Gene Name SLC6A4
1 Preclinical Drug(s) Transported by This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Oxypertine DMYKG8R N. A. N. A. Preclinical [107]
------------------------------------------------------------------------------------
1 Investigative Drug(s) Transported by This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
SEROTONIN DMOFCRY Discovery agent N.A. Investigative [108]
------------------------------------------------------------------------------------

References

1 Psychopharmacological treatment of dermatological patients--when simply talking does not help. J Dtsch Dermatol Ges. 2007 Dec;5(12):1101-6.
2 Augmentation effect of combination therapy of aripiprazole and antidepressants on forced swimming test in mice. Psychopharmacology (Berl). 2009 Sep;206(1):97-107.
3 Pharmacotherapy for obesity. Drugs. 2005;65(10):1391-418.
4 Treatment of comorbid pain with serotonin norepinephrine reuptake inhibitors. CNS Spectr. 2008 Jul;13(7 Suppl 11):22-6.
5 Clinically relevant drug interactions with new generation antidepressants and antipsychotics. Ther Umsch. 2009 Jun;66(6):485-92.
6 Aminorex, fenfluramine, and chlorphentermine are serotonin transporter substrates.Implications for primary pulmonary hypertension.Circulation.1999 Aug 24;100(8):869-75.
7 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
8 Efficacy of treatments for patients with obsessive-compulsive disorder: a systematic review. J Am Acad Nurse Pract. 2009 Apr;21(4):207-13.
9 Differential involvement of the norepinephrine, serotonin and dopamine reuptake transporter proteins in cocaine-induced taste aversion. Pharmacol Biochem Behav. 2009 Jul;93(1):75-81.
10 Dasotraline for the Treatment of Attention-Deficit/Hyperactivity Disorder: A Randomized, Double-Blind, Placebo-Controlled, Proof-of-Concept Trial in Adults. Neuropsychopharmacology. 2015 Nov;40(12):2745-52.
11 2008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6.
12 Multi-target therapeutics: when the whole is greater than the sum of the parts. Drug Discov Today. 2007 Jan;12(1-2):34-42.
13 Antidepressants and sleep: a review. Perspect Psychiatr Care. 2009 Jul;45(3):191-7.
14 Changes of functional MRI findings in a patient whose pathological gambling improved with fluvoxamine. Yonsei Med J. 2009 Jun 30;50(3):441-4.
15 Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
16 Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
17 Emerging treatments for depression. Expert Opin Pharmacother. 2006 Dec;7(17):2323-39.
18 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4.
19 Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651.
20 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 928).
21 Antitussives and substance abuse. Subst Abuse Rehabil. 2013 Nov 6;4:75-82.
22 Preclinical Evaluation of the Abuse Potential of the Analgesic Bicifadine
23 Clinical pipeline report, company report or official report of Intra-Cellular Therapies, Inc.
24 Litoxetine: a selective 5-HT uptake inhibitor with concomitant 5-HT3 receptor antagonist and antiemetic properties. Eur J Pharmacol. 1993 Mar 2;232(2-3):139-45.
25 Brasofensine NeuroSearch. Curr Opin Investig Drugs. 2000 Dec;1(4):504-7.
26 Clinical pipeline report, company report or official report of Clera Inc.
27 Effect of DA-8031, a novel oral compound for premature ejaculation, on male rat sexual behavior. Int J Urol. 2014 Mar;21(3):325-9.
28 Encyclopedia of Psychopharmacology. Ian Stolerman. 2010. Page(105).
29 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
30 Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92.
31 Preclinical to clinical translation of CNS transporter occupancy of TD-9855, a novel norepinephrine and serotonin reuptake inhibitor. Int J Neuropsychopharmacol. 2014 Dec 13;18(2). pii: pyu027.
32 Bifeprunox: a partial agonist at dopamine D2 and serotonin 1A receptors, influences nicotine-seeking behaviour in response to drug-associated stimuli in rats.Addict Biol.2012 Mar;17(2):274-86.
33 Company report (BioLineRx)
34 Monoamine transporter occupancy of a novel triple reuptake inhibitor in baboons and humans using positron emission tomography. J Pharmacol Exp Ther. 2013 Aug;346(2):311-7.
35 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028715)
36 Progress in the development of histamine H3 receptor antagonists/inverse agonists: a patent review (2013-2017).Expert Opin Ther Pat. 2018 Mar;28(3):175-196.
37 Serotonergic drugs : effects on appetite expression and use for the treatment of obesity. Drugs. 2007;67(1):27-55.
38 Nontricyclic antidepressant agents derived from cis- and trans-1-amino-4-aryltetralins. J Med Chem. 1984 Nov;27(11):1508-15.
39 Clinical pipeline report, company report or official report of Neurosearch.
40 Monoamine reuptake site occupancy of sibutramine: Relationship to antidepressant-like and thermogenic effects in rats.Eur J Pharmacol.2014 Aug 15;737:47-56.
41 Dopamine uptake inhibitor-induced rotation in 6-hydroxydopamine-lesioned rats involves both D1 and D2 receptors but is modulated through 5-hydroxyt... J Pharmacol Exp Ther. 2005 Mar;312(3):1124-31.
42 Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23.
43 NSD-644: Phase I started.NeuroSearch A/S (CSE:NEUR), Ballerup, Denmark, GlaxoSmithKline plc (LSE:GSK; GSK), London, U.K.
44 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031598)
45 Syntheses and binding affinities of 6-nitroquipazine analogues for serotonin transporter. Part 5: 2'-Substituted 6-nitroquipazines. Bioorg Med Chem. 2007 May 15;15(10):3499-504.
46 Structure-activity studies for a novel series of N-(arylethyl)-N-(1,2,3,4-tetrahydronaphthalen-1-ylmethyl)-N-methylamine s possessing dual 5-HT upt... J Med Chem. 1997 Mar 28;40(7):1049-62.
47 Antihypertensive activity in a series of 1-piperazino-3-phenylindans with potent 5-HT2-antagonistic activity. J Med Chem. 1988 Dec;31(12):2247-56.
48 Moxidectin causes adult worm mortality of human lymphatic filarial parasite Brugia malayi in rodent models. Folia Parasitol (Praha). 2014 Dec;61(6):561-70.
49 Synthesis and structure-activity relationships of selective norepinephrine reuptake inhibitors (sNRI) with a heterocyclic ring constraint. Bioorg Med Chem Lett. 2008 Aug 15;18(16):4495-8.
50 Design and optimization of selective serotonin re-uptake inhibitors with high synthetic accessibility. Part 1. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2329-32.
51 Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31.
52 New iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. Bioorg Med Chem Lett. 2008 Sep 15;18(18):4940-3.
53 Design and synthesis of (2R,3S)-iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. Bioorg Med Chem Lett. 2009 Sep 1;19(17):4996-8.
54 Studies on the structure-activity relationship of bicifadine analogs as monoamine transporter inhibitors. Bioorg Med Chem Lett. 2008 Jul 1;18(13):3682-6.
55 Second generation N-(1,2-diphenylethyl)piperazines as dual serotonin and noradrenaline reuptake inhibitors: improving metabolic stability and reduc... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3788-92.
56 1-Naphthyl and 4-indolyl arylalkylamines as selective monoamine reuptake inhibitors. Bioorg Med Chem Lett. 2009 Jan 1;19(1):58-61.
57 Bioorg Med Chem Lett. 2009 Oct 15;19(20):5893-7. Epub 2009 Aug 21.Design and optimisation of selective serotonin re-uptake inhibitors with high synthetic accessibility: part 2.
58 Stereoselective inhibition of serotonin re-uptake and phosphodiesterase by dual inhibitors as potential agents for depression. Bioorg Med Chem. 2009 Jan 1;17(1):337-43.
59 Inhibition of serotonin and norepinephrine reuptake and inhibition of phosphodiesterase by multi-target inhibitors as potential agents for depression. Bioorg Med Chem. 2009 Oct 1;17(19):6890-7.
60 N-(1,2-diphenylethyl)piperazines: a new class of dual serotonin/noradrenaline reuptake inhibitor. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4345-8.
61 Structure-activity relationships of N-substituted piperazine amine reuptake inhibitors. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4349-53.
62 Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1... Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7.
63 1-(4-Methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one (Pyrovalerone) analogues: a promising class of monoamine uptake inhibitors. J Med Chem. 2006 Feb 23;49(4):1420-32.
64 Synthesis and pharmacological evaluation of 3-(3,4-dichlorophenyl)-1-indanamine derivatives as nonselective ligands for biogenic amine transporters. J Med Chem. 2004 May 6;47(10):2624-34.
65 Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for cocaine addiction. J Med Chem. 2009 Nov 12;52(21):6768-81.
66 Synthesis and serotonin transporter activity of sulphur-substituted alpha-alkyl phenethylamines as a new class of anticancer agents. Eur J Med Chem. 2009 Dec;44(12):4862-88.
67 Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for smoking cessation. J Med Chem. 2010 Mar 11;53(5):2204-14.
68 Synthesis and pharmacology of site-specific cocaine abuse treatment agents: restricted rotation analogues of methylphenidate. J Med Chem. 2007 May 31;50(11):2718-31.
69 Synthesis, dopamine and serotonin transporter binding affinities of novel analogues of meperidine. Bioorg Med Chem Lett. 1999 Dec 6;9(23):3273-6.
70 Des-keto lobeline analogs with increased potency and selectivity at dopamine and serotonin transporters. Bioorg Med Chem Lett. 2006 Oct 1;16(19):5018-21.
71 Characterization of thien-2-yl 1S,2R-milnacipran analogues as potent norepinephrine/serotonin transporter inhibitors for the treatment of neuropath... J Med Chem. 2008 Nov 27;51(22):7265-72.
72 2,5-Disubstituted tetrahydrofurans as selective serotonin re-uptake inhibitors. Bioorg Med Chem. 2009 Mar 1;17(5):2047-68.
73 Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agon... Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7.
74 Syntheses and binding affinities of 6-nitroquipazine analogues for serotonin transporter. Part 1. Bioorg Med Chem Lett. 2000 Jul 17;10(14):1559-62.
75 Synthesis and activity of novel 1- or 3-(3-amino-1-phenyl propyl)-1,3-dihydro-2H-benzimidazol-2-ones as selective norepinephrine reuptake inhibitors. Bioorg Med Chem Lett. 2008 Dec 1;18(23):6067-70.
76 Conformationally restricted homotryptamines. Part 4: Heterocyclic and naphthyl analogs of a potent selective serotonin reuptake inhibitor. Bioorg Med Chem Lett. 2007 Oct 15;17(20):5647-51.
77 Synthesis and monoamine transporter affinity of 3alpha-arylmethoxy-3beta-arylnortropanes. Bioorg Med Chem Lett. 2009 Dec 15;19(24):6865-8.
78 Conformationally restricted homotryptamines. Part 7: 3-cis-(3-aminocyclopentyl)indoles as potent selective serotonin reuptake inhibitors. J Med Chem. 2010 Nov 11;53(21):7564-72.
79 3alpha-(4-Substituted phenyl)nortropane-2beta-carboxylic acid methyl esters show selective binding at the norepinephrine transporter. Bioorg Med Chem Lett. 2000 Nov 6;10(21):2445-7.
80 Structure-activity relationship studies on a novel series of (S)-2beta-substituted 3alpha-[bis(4-fluoro- or 4-chlorophenyl)methoxy]tropane analogue... J Med Chem. 2006 Oct 19;49(21):6391-9.
81 Conformationally restricted homotryptamines 3. Indole tetrahydropyridines and cyclohexenylamines as selective serotonin reuptake inhibitors. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3099-104.
82 Designing rapid onset selective serotonin re-uptake inhibitors. 2: structure-activity relationships of substituted (aryl)benzylamines. Bioorg Med Chem Lett. 2008 Jul 15;18(14):4018-21.
83 Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
84 Syntheses and binding affinities of 6-nitroquipazine analogues for serotonin transporter. Part 2: 4-substituted 6-nitroquipazines. Bioorg Med Chem Lett. 2002 Mar 11;12(5):811-5.
85 Lobeline esters as novel ligands for neuronal nicotinic acetylcholine receptors and neurotransmitter transporters. Bioorg Med Chem. 2010 Jan 15;18(2):640-9.
86 Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.
87 Derivatives of (3S)-N-(biphenyl-2-ylmethyl)pyrrolidin-3-amine as selective noradrenaline reuptake inhibitors: Reducing P-gp mediated efflux by modu... Bioorg Med Chem Lett. 2008 Aug 1;18(15):4355-9.
88 Synthesis and evaluation of dopamine and serotonin transporter inhibition by oxacyclic and carbacyclic analogues of methylphenidate. J Med Chem. 2003 Apr 10;46(8):1538-45.
89 Further structural optimization of cis-(6-benzhydryl-piperidin-3-yl)-benzylamine and 1,4-diazabicyclo[3.3.1]nonane derivatives by introducing an ex... Bioorg Med Chem. 2008 Mar 15;16(6):2769-78.
90 N-Alkyl-N-arylmethylpiperidin-4-amines: novel dual inhibitors of serotonin and norepinephrine reuptake. Bioorg Med Chem Lett. 2006 May 15;16(10):2714-8.
91 Synthesis and biological activity of piperazine and diazepane amides that are histamine H3 antagonists and serotonin reuptake inhibitors. Bioorg Med Chem Lett. 2008 Jan 1;18(1):39-43.
92 Design, synthesis, and evaluation of 10-N-substituted acridones as novel chemosensitizers in Plasmodium falciparum. Antimicrob Agents Chemother. 2007 Nov;51(11):4133-40.
93 The origin of MDMA (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5.
94 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
95 1-(2-Phenoxyphenyl)methanamines: SAR for dual serotonin/noradrenaline reuptake inhibition, metabolic stability and hERG affinity. Bioorg Med Chem Lett. 2008 Jan 15;18(2):596-9.
96 Studies on the SAR and pharmacophore of milnacipran derivatives as monoamine transporter inhibitors. Bioorg Med Chem Lett. 2008 Feb 15;18(4):1346-9.
97 Norzotepine, a major metabolite of zotepine, exerts atypical antipsychotic-like and antidepressant-like actions through its potent inhibition of norepinephrine reuptake. J Pharmacol Exp Ther. 2010 Jun;333(3):772-81.
98 Derivatives of tramadol for increased duration of effect. Bioorg Med Chem Lett. 2006 Feb;16(3):691-4.
99 Design, synthesis and evaluation of N-[(3S)-pyrrolidin-3-yl]benzamides as selective noradrenaline reuptake inhibitors: CNS penetration in a more po... Bioorg Med Chem Lett. 2009 Aug 15;19(16):4579-83.
100 Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-a... Bioorg Med Chem. 2007 Jun 1;15(11):3649-60.
101 Synthesis, monoamine transporter binding, properties, and functional monoamine uptake activity of 3beta-[4-methylphenyl and 4-chlorophenyl]-2 beta-... J Med Chem. 2007 Jul 26;50(15):3686-95.
102 Discovery of a new series of centrally active tricyclic isoxazoles combining serotonin (5-HT) reuptake inhibition with alpha2-adrenoceptor blocking... J Med Chem. 2005 Mar 24;48(6):2054-71.
103 Neuroleptic activity and dopamine-uptake inhibition in 1-piperazino-3-phenylindans. J Med Chem. 1983 Jul;26(7):935-47.
104 Discovery of a potent, selective, and less flexible selective norepinephrine reuptake inhibitor (sNRI). Bioorg Med Chem Lett. 2008 Jul 15;18(14):4224-7.
105 Monoamine transporter binding, locomotor activity, and drug discrimination properties of 3-(4-substituted-phenyl)tropane-2-carboxylic acid methyl e... J Med Chem. 2004 Dec 2;47(25):6401-9.
106 3 alpha-(4'-substituted phenyl)tropane-2 beta-carboxylic acid methyl esters: novel ligands with high affinity and selectivity at the dopamine trans... J Med Chem. 1996 Oct 11;39(21):4139-41.
107 Serotonin transporter gene and treatment of alcoholism.
108 Serotonin transporter gene, depressive symptoms, and interleukin-6. Circ Cardiovasc Genet. 2009 Dec;2(6):614-20.