Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTJQOD7)

• DTT Name: 5-HT 2A receptor (HTR2A)
• Synonyms: Serotonin receptor 2A; HTR2; 5-hydroxytryptamine receptor 2A; 5-HT-2A; 5-HT-2
• Gene Name: HTR2A
• DTT Type: Successful target; [1]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: 5HT2A_HUMAN
• TTD ID: T32060
• Sequence:
  MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
  LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
  MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
  IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
  VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
  REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
  LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
  SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
• Function: G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.
• KEGG Pathway:
  Calcium signaling pathway (hsa04020)
  Neuroactive ligand-receptor interaction (hsa04080)
  Gap junction (hsa04540)
  Serotonergic synapse (hsa04726)
  Inflammatory mediator regulation of TRP channels (hsa04750)
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  Serotonin receptors (R-HSA-390666)

Molecular Interaction Atlas (MIA) of This DTT

9 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aniracetam	DMOIFW0	Cerebrovascular ischaemia	8B1Z	Approved	[2]
Flibanserin	DM70DTN	Depression	6A70-6A7Z	Approved	[3]
Iloperidone	DM6AUFY	Schizophrenia	6A20	Approved	[4]
lumateperone tosylate	DMQ8HOJ	Schizophrenia	6A20	Approved	[5]
Lurasidone hydrochloride	DMCVPXO	Schizophrenia	6A20	Approved	[6]
Metergolin	DMJFP6G	Hyperprolactinaemia	5A60.1	Approved	[7]
Pimavanserin	DMR7IVC	Parkinson disease	8A00.0	Approved	[8]
Sarpogrelate	DMGLP6S	Diabetic complication	5A2Y	Approved	[1]
ZOTEPINE	DMF3VXA	Anxiety disorder	6B00-6B0Z	Approved	[9]

23 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Blonanserin	DM36C17	Schizophrenia	6A20	Phase 3	[10]
ITI-007	DMUQ1DO	Depression	6A70-6A7Z	Phase 3	[11]
M100907	DM7ZFBA	Sleep-wake disorder	7A00-7B2Z	Phase 3	[12]
MIN-101	DMCJY35	Schizophrenia	6A20	Phase 3	[13]
SR46349B	DM1ODMR	Primary insomnia	7A00	Phase 3	[14]
TNX-102	DMO1234	Fibromyalgia	MG30.01	Phase 3	[15]
TRYPTAMINE	DMAFPHB	N. A.	N. A.	Phase 3	[16]
Zicronapine	DMP8ESD	Schizophrenia	6A20	Phase 3	[17]
BVT.28949	DM8CWL0	Glaucoma/ocular hypertension	9C61	Phase 2	[18]
FKW00GA	DMPXH7N	Social phobia	6B04	Phase 2	[19]
NELOTANSERIN	DM4LKFO	Lewy body dementia	6D82	Phase 2	[20]
Nuplazid	DMOJA5G	Alzheimer disease	8A20	Phase 2	[21]
Ocaperidone	DMP6B59	Idiopathic pulmonary fibrosis	CB03.4	Phase 2	[13]
PRUVANSERIN	DMM7F1E	Sleep-wake disorder	7A00-7B2Z	Phase 2	[22]
RP5063	DMKUE8O	Schizophrenia	6A20	Phase 2	[19]
SYN120	DMDF7XB	Parkinson disease	8A00.0	Phase 2	[23]
1192U90	DM5IPHE	Psychotic disorder	6A20-6A25	Phase 1	[10]
Abaperidone	DMYFB10	Schizophrenia	6A20	Phase 1	[24]
ATI-9242	DM6GKMU	Schizophrenia	6A20	Phase 1	[25]
DSP-1200	DM4WSHG	Depression	6A70-6A7Z	Phase 1	[19]
SKL-10406	DMW64UZ	Major depressive disorder	6A70.3	Phase 1	[26]
Temanogrel	DM7Q4EX	Cardiovascular disease	BA00-BE2Z	Phase 1	[27]
YKP-1358	DMKHVNE	Schizoaffective disorder	6A21	Phase 1	[28]

34 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
3-phenyl pyrazole derivative 1	DM3VB6G	N. A.	N. A.	Patented	[29]
Aryl piperazine derivative 1	DM9DJGU	N. A.	N. A.	Patented	[30]
Aryl piperazine derivative 6	DMZ3DS5	N. A.	N. A.	Patented	[30]
Aryl piperazine derivative 9	DMLKNWF	N. A.	N. A.	Patented	[29]
Benzoyl-piperidine derivative 1	DMJBOL0	N. A.	N. A.	Patented	[29]
Benzoyl-piperidine derivative 2	DMFKX1M	N. A.	N. A.	Patented	[29]
Diarylamine and arylheteroarylamine pyrazole derivative 1	DMXFNOD	N. A.	N. A.	Patented	[29]
Diarylamine and arylheteroarylamine pyrazole derivative 2	DM6NR9Y	N. A.	N. A.	Patented	[29]
Diarylamine and arylheteroarylamine pyrazole derivative 3	DMLZ1UB	N. A.	N. A.	Patented	[29]
L-piperazino-3-phenyl-indane derivative 1	DM1STAD	N. A.	N. A.	Patented	[29]
Piperazine derivative 3	DM8MZR6	N. A.	N. A.	Patented	[29]
Piperazine derivative 4	DM2XGNY	N. A.	N. A.	Patented	[29]
PMID26609882-Compound-34	DMBYTSI	N. A.	N. A.	Patented	[29]
PMID26609882-Compound-35	DM8OLYQ	N. A.	N. A.	Patented	[29]
PMID26609882-Compound-36	DMFT3RM	N. A.	N. A.	Patented	[29]
PMID30124346-Compound-13TABLE4	DMHTJVA	Attention deficit hyperactivity disorder	6A05.Z	Patented	[30]
PMID30124346-Compound-34TABLE4	DM2G3VE	Attention deficit hyperactivity disorder	6A05.Z	Patented	[30]
PMID30124346-Compound-LDT8	DM5MUNG	Benign prostatic hyperplasia	GA90	Patented	[30]
Pyrazole derivative 67	DMNZUHX	N. A.	N. A.	Patented	[29]
Pyrazole derivative 68	DMVY0JT	N. A.	N. A.	Patented	[29]
Pyrazole derivative 69	DMKCJE1	N. A.	N. A.	Patented	[29]
Pyrazole derivative 70	DMR6VIG	N. A.	N. A.	Patented	[29]
Pyrazole derivative 71	DMSNY3W	N. A.	N. A.	Patented	[29]
Pyrazole derivative 72	DMWFTCN	N. A.	N. A.	Patented	[29]
Pyrazole derivative 73	DMFARIK	N. A.	N. A.	Patented	[29]
Pyrazole derivative 74	DM70QPF	N. A.	N. A.	Patented	[29]
Pyrazole derivative 75	DMAB2EN	N. A.	N. A.	Patented	[29]
Pyrimidine derivative 23	DM5MLQU	N. A.	N. A.	Patented	[29]
Pyrimidine derivative 24	DMOQ726	N. A.	N. A.	Patented	[29]
Pyrimidine derivative 25	DM51MFS	N. A.	N. A.	Patented	[29]
Pyrimidine derivative 26	DM90WKN	N. A.	N. A.	Patented	[29]
Pyrimidine derivative 27	DMIQSDW	N. A.	N. A.	Patented	[29]
Pyrimidine derivative 28	DM1D2AS	N. A.	N. A.	Patented	[29]
Pyrimidine derivative 29	DMVOYJ8	N. A.	N. A.	Patented	[29]

28 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
LYSERGIC ACID DIETHYLAMIDE	DMACMLO	Addictive disorder	6C50-6C5Z	Withdrawn from market	[31]
Deramciclane	DM8DUZT	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 3	[32]
Iferanserin-Ventrus	DMDEL2W	Hemorrhoids	DB60	Discontinued in Phase 3	[33]
MDL-11939	DMUR3VP	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 3	[34]
Ritanserin	DM0X36Y	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 3	[35]
TIOSPIRONE	DME5QDP	N. A.	N. A.	Discontinued in Phase 3	[36]
Adatanserin	DMMKFUP	Mood disorder	6A60-6E23	Discontinued in Phase 2	[37]
AMESERGIDE	DMRY9V8	Mood disorder	6A60-6E23	Discontinued in Phase 2	[38]
FCE-22716	DMT2Z1L	Hypertension	BA00-BA04	Discontinued in Phase 2	[39]
MAZAPERTINE	DMRHYAU	N. A.	N. A.	Discontinued in Phase 2	[40]
SERAZAPINE HYDROCHLORIDE	DM75ZO0	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 2	[41]
SERGOLEXOLE MALEATE	DM9KB8A	Migraine	8A80	Discontinued in Phase 2	[42]
SL65.0472	DMU5RKC	Cardiovascular disease	BA00-BE2Z	Discontinued in Phase 2	[43]
YM-992	DM845NM	Depression	6A70-6A7Z	Discontinued in Phase 2	[44]
AM-831	DMO7920	Schizophrenia	6A20	Discontinued in Phase 1	[45]
DUP-734	DMI5EPB	Psychotic disorder	6A20-6A25	Discontinued in Phase 1	[46]
A-80426	DMBC3DG	N. A.	N. A.	Terminated	[47]
AMPEROZIDE	DMDAMBW	Alcohol dependence	6C40.2	Terminated	[48]
DV-7028	DMKNJM7	Cardiovascular disease	BA00-BE2Z	Terminated	[49]
Fananserin	DME694O	Schizophrenia	6A20	Terminated	[50]
GMC-283	DMT1RH6	Schizophrenia	6A20	Terminated	[10]
ICI-169369	DMQ0IOF	Anxiety disorder	6B00-6B0Z	Terminated	[51]
LY53857	DMY71LJ	N. A.	N. A.	Terminated	[52]
MDL-28161	DM8ZDU2	N. A.	N. A.	Terminated	[34]
R-102444	DM46YHG	Pancreatitis	DC31-DC34	Terminated	[53]
Ro-60-0175	DMZSQU8	N. A.	N. A.	Terminated	[54]
RP-68303	DM0BEM3	N. A.	N. A.	Terminated	[55]
ZD-3638	DM6M9GC	Schizophrenia	6A20	Terminated	[10]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Org-23366	DMHQUM2	Schizophrenia	6A20	Preclinical	[10]

219 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+/-)-nantenine	DM0L3GE	Discovery agent	N.A.	Investigative	[56]
(1-Phenethyl-piperidin-4-yl)-phenyl-methanone	DMXY9R5	Discovery agent	N.A.	Investigative	[9]
(2-Indol-1-yl-ethyl)-dimethyl-amine	DM24E08	Discovery agent	N.A.	Investigative	[57]
(2S)-1-(1H-furo[2,3-g]indazol-1-yl)propan-2-amine	DMIS39C	Discovery agent	N.A.	Investigative	[54]
(2S)-1-(5-fluoro-1H-indazol-1-yl)propan-2-amine	DMW4ARM	Discovery agent	N.A.	Investigative	[54]
(2S)-1-(6-fluoro-1H-indazol-1-yl)propan-2-amine	DM31SNW	Discovery agent	N.A.	Investigative	[54]
(2S)-1-(6-methoxy-1H-indazol-1-yl)propan-2-amine	DMYALON	Discovery agent	N.A.	Investigative	[58]
(E)-2-(4-fluorostyryl)-5-(phenylsulfinyl)pyridine	DMTJI4F	Discovery agent	N.A.	Investigative	[59]
(E)-2-(4-fluorostyryl)-5-(phenylsulfonyl)pyridine	DM7P5VM	Discovery agent	N.A.	Investigative	[59]
(R)-(+)-(4,5,6-trimethoxyindan-1-yl)methanamine	DM9DBHU	Discovery agent	N.A.	Investigative	[31]
(R)-(-)-11-hydroxy-N-n-propylnoraporphine	DMKB621	Discovery agent	N.A.	Investigative	[60]
(R)-1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine	DMDC297	Discovery agent	N.A.	Investigative	[61]
(R)-3-(4-propylmorpholin-2-yl)phenol	DMC73DY	Discovery agent	N.A.	Investigative	[62]
(R,S)-1-(5-bromo-1H-indol-1-yl)propan-2-amine	DMKZ4C6	Discovery agent	N.A.	Investigative	[63]
(R,S)-1-(5-chloro-1H-indol-1-yl)propan-2-amine	DMTZDAJ	Discovery agent	N.A.	Investigative	[63]
(R,S)-1-(5-fluoro-1H-indol-1-yl)propan-2-amine	DMAU1M5	Discovery agent	N.A.	Investigative	[63]
(R,S)-1-(5-methyl-1H-indol-1-yl)propan-2-amine	DMS2DI9	Discovery agent	N.A.	Investigative	[63]
(R,S)-1-(6-fluoro-1H-indol-1-yl)propan-2-amine	DM0YELX	Discovery agent	N.A.	Investigative	[63]
(S)-(-)-(4,5,6-trimethoxyindan-1-yl)methanamine	DMUNQY7	Discovery agent	N.A.	Investigative	[31]
(S)-1-(5,6-difluoro-1H-indol-1-yl)propan-2-amine	DMEIB8F	Discovery agent	N.A.	Investigative	[63]
1,2,3,4-Tetrahydro-naphthalen-2-ylamine	DMP4DLV	Discovery agent	N.A.	Investigative	[64]
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole	DM3JGVF	Discovery agent	N.A.	Investigative	[57]
1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane	DMDFU6S	Discovery agent	N.A.	Investigative	[65]
1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane	DMNLUKS	Discovery agent	N.A.	Investigative	[65]
1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane	DM0GRMD	Discovery agent	N.A.	Investigative	[65]
1,6-bis(4-m-tolylpiperazin-1-yl)hexane	DM5Z6XG	Discovery agent	N.A.	Investigative	[65]
1,6-bis(4-phenylpiperazin-1-yl)hexane	DMD3EUI	Discovery agent	N.A.	Investigative	[65]
1-((R)-2-aminopropyl)-1H-indazol-6-ol	DM74R0E	Discovery agent	N.A.	Investigative	[58]
1-((S)-2-aminopropyl)-1H-indazol-6-ol	DMU83KP	Discovery agent	N.A.	Investigative	[58]
1-((S)-2-aminopropyl)-7-chloro-1H-indazol-6-ol	DMRFJNC	Discovery agent	N.A.	Investigative	[58]
1-((S)-2-aminopropyl)-7-fluoro-1H-indazol-6-ol	DM76JVB	Discovery agent	N.A.	Investigative	[58]
1-((S)-2-aminopropyl)-7-iodo-1H-indazol-6-ol	DMR2SXL	Discovery agent	N.A.	Investigative	[58]
1-((S)-2-aminopropyl)-7-methyl-1H-indazol-6-ol	DM8MNZG	Discovery agent	N.A.	Investigative	[58]
1-(10-Bromoanthracen-9-yl)-2-aminopropane	DM2AEO0	Discovery agent	N.A.	Investigative	[66]
1-(2,5-Dimethoxy-4-methyl-phenyl)-piperazine	DM31CVR	Discovery agent	N.A.	Investigative	[67]
1-(2,5-Dimethoxy-phenyl)-piperazine	DMNETHQ	Discovery agent	N.A.	Investigative	[67]
1-(2,5-dimethoxyphenyl)propan-2-amine	DM043N8	Discovery agent	N.A.	Investigative	[66]
1-(2,6-dimethoxy-4-methylphenyl)propan-2-amine	DMV0C6F	Discovery agent	N.A.	Investigative	[66]
1-(2-aminoethyl)-1H-indazol-6-ol	DMKWO6A	Discovery agent	N.A.	Investigative	[58]
1-(2-Methoxy-phenyl)-4-propyl-piperazine	DMCADRI	Discovery agent	N.A.	Investigative	[68]
1-(2-Methoxy-phenyl)-piperazine	DM3M4RA	Discovery agent	N.A.	Investigative	[67]
1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine	DMX5N3V	Discovery agent	N.A.	Investigative	[69]
1-(3-(phenylthio)propyl)-4-m-tolylpiperazine	DMXUNMW	Discovery agent	N.A.	Investigative	[70]
1-(4-Bromo-2,5-difluorophenyl)-2-aminopropane	DMMLCSG	Discovery agent	N.A.	Investigative	[66]
1-(4-Bromo-2,5-dimethoxy-phenyl)-piperazine	DMCH6R1	Discovery agent	N.A.	Investigative	[67]
1-(4-ethyl-2,5-dimethoxyphenyl)propan-2-amine	DMIYLXU	Discovery agent	N.A.	Investigative	[66]
1-Butyl-3-(2-dimethylamino-ethyl)-1H-indol-4-ol	DMO7NXE	Discovery agent	N.A.	Investigative	[71]
1-Butyl-4-(2-methoxy-phenyl)-piperazine	DM6QULO	Discovery agent	N.A.	Investigative	[68]
1-Ethyl-4-(2-methoxy-phenyl)-piperazine	DMGKP9Y	Discovery agent	N.A.	Investigative	[68]
1-methoxy-9-aminomethyl-9,10-dihydroanthracene	DMAUZHJ	Discovery agent	N.A.	Investigative	[72]
1-Methyl-1,3-dihydro-indol-2-one	DMMX7V8	Discovery agent	N.A.	Investigative	[73]
1-Naphthalen-2-yl-piperazine	DMJK0MF	Discovery agent	N.A.	Investigative	[64]
1-naphthylpiperazine	DM6BIWK	Discovery agent	N.A.	Investigative	[64]
1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine	DMOCAUL	Discovery agent	N.A.	Investigative	[74]
11-Butyryloxy-N-n-propylnoraporphine	DMH5QEA	Discovery agent	N.A.	Investigative	[60]
11-Heptanoyloxy-N-n-propylnoraporphine	DMX4I9D	Discovery agent	N.A.	Investigative	[60]
11-Hexanoyloxy-N-n-propylnoraporphine	DMRYV9E	Discovery agent	N.A.	Investigative	[60]
11-Propionyloxy-N-n-propylnoraporphine	DM62FEH	Discovery agent	N.A.	Investigative	[60]
11-valeryloxynoraporphine	DMM91WE	Discovery agent	N.A.	Investigative	[60]
2,2-Diphenyl-ethylamine	DMTBAUG	Discovery agent	N.A.	Investigative	[75]
2,5-dimethoxy-4-bromophenethylamine	DM50ZQP	Discovery agent	N.A.	Investigative	[76]
2-(1H-indol-3-yl)-N,N-dimethylethanamine	DMR9Q4Y	Discovery agent	N.A.	Investigative	[77]
2-(2-Amino-propyl)-5-bromo-4-methoxy-phenol	DMZNRFG	Discovery agent	N.A.	Investigative	[78]
2-(2-Methoxy-phenyl)-1-methyl-ethylamine	DMDI98B	Discovery agent	N.A.	Investigative	[78]
2-(3,5-dimethoxy-4-phenethoxyphenyl)ethanamine	DMIEB8R	Discovery agent	N.A.	Investigative	[66]
2-(3-Methoxy-phenyl)-1-methyl-ethylamine	DM4C9H2	Discovery agent	N.A.	Investigative	[78]
2-(4-Bromo-2-methoxy-phenyl)-1-methyl-ethylamine	DM79JVK	Discovery agent	N.A.	Investigative	[78]
2-(4-Bromo-phenyl)-1-methyl-ethylamine	DMB49UP	Discovery agent	N.A.	Investigative	[78]
2-(4-Methyl-piperazin-1-yl)-4-phenyl-pyrimidine	DMDHFU9	Discovery agent	N.A.	Investigative	[79]
2-(5-Methoxy-1H-indol-3-yl)-1-methyl-ethylamine	DM1O0JD	Discovery agent	N.A.	Investigative	[58]
2-(9,10-dihydroanthracen-9-yl)-N-methylethanamine	DMRW475	Discovery agent	N.A.	Investigative	[80]
2-(piperazin-1-yl)-5,6,7,8-tetrahydroquinoline	DML6HSE	Discovery agent	N.A.	Investigative	[81]
2-methoxy-9-aminomethyl-9,10-dihydroanthracene	DMXCAKO	Discovery agent	N.A.	Investigative	[72]
2-Phenyl-3-(2-piperidin-1-yl-ethyl)-1H-indole	DM5YC2K	Discovery agent	N.A.	Investigative	[82]
2-Phenyl-3-piperidin-4-yl-1H-indole	DMEXZQ5	Discovery agent	N.A.	Investigative	[82]
2-Piperazin-1-yl-phenol	DMQT9OK	Discovery agent	N.A.	Investigative	[67]
3-(1-Benzyl-piperidin-4-yl)-2-phenyl-1H-indole	DMWP0VK	Discovery agent	N.A.	Investigative	[82]
3-(1-Methyl-piperidin-4-yl)-2-phenyl-1H-indole	DM6R5HU	Discovery agent	N.A.	Investigative	[82]
3-(1-Phenethyl-piperidin-4-yl)-2-phenyl-1H-indole	DM8TH2N	Discovery agent	N.A.	Investigative	[82]
3-(2-Amino-propyl)-1H-indol-5-ol	DMQPNUM	Discovery agent	N.A.	Investigative	[58]
3-(2-Dimethylamino-ethyl)-1-methyl-1H-indol-4-ol	DMKYZGD	Discovery agent	N.A.	Investigative	[71]
3-(2-Dimethylamino-ethyl)-1H-indol-6-ol	DM32MIE	Discovery agent	N.A.	Investigative	[71]
3-(2-Dimethylamino-ethyl)-2-methyl-1H-indol-4-ol	DM9BTLC	Discovery agent	N.A.	Investigative	[71]
3-(2-Dimethylamino-propyl)-1H-indol-4-ol	DMMJP9D	Discovery agent	N.A.	Investigative	[71]
3-(2-Pyrrolidin-1-yl-ethyl)-1H-indol-4-ol	DM7VJPX	Discovery agent	N.A.	Investigative	[71]
3-(3-Dimethylamino-propyl)-1H-indol-4-ol	DM0O2ZB	Discovery agent	N.A.	Investigative	[71]
3-Amino-1-(2-amino-5-methoxy-phenyl)-propan-1-one	DMKGIQ1	Discovery agent	N.A.	Investigative	[67]
3-Dimethylaminomethyl-1-methyl-1H-indol-4-ol	DMDOIJM	Discovery agent	N.A.	Investigative	[71]
3-Dimethylaminomethyl-1H-indol-4-ol	DMSJUOH	Discovery agent	N.A.	Investigative	[71]
3-methoxy-9-aminomethyl-9,10-dihydroanthracene	DMO2N56	Discovery agent	N.A.	Investigative	[72]
3-Naphthalen-1-yl-1-propyl-pyrrolidine	DMNZI9R	Discovery agent	N.A.	Investigative	[74]
3-Naphthalen-1-yl-pyrrolidine	DMCW7F5	Discovery agent	N.A.	Investigative	[74]
4,4-Diphenylbutan-1-amine	DMQ0TBX	Discovery agent	N.A.	Investigative	[80]
4-(10H-Anthracen-9-ylidene)-1-methyl-piperidine	DM1SP36	Discovery agent	N.A.	Investigative	[75]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[83]
4-(4-Fluoro-benzyl)-piperidine hydrochloride	DM4NEOU	Discovery agent	N.A.	Investigative	[34]
4-Benzyl-1-methyl-piperidine hydrochloride	DMQKCGI	Discovery agent	N.A.	Investigative	[34]
4-methoxy-9-aminomethyl-9,10-dihydroanthracene	DM54A3W	Discovery agent	N.A.	Investigative	[72]
5,6-dichloro-3,4-dihydroquinazolin-2-amine	DMN1S35	Discovery agent	N.A.	Investigative	[84]
5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline	DMMI4H3	Discovery agent	N.A.	Investigative	[85]
5-chloro-3,4-dihydroquinazolin-2-amine	DMKEFJ0	Discovery agent	N.A.	Investigative	[84]
5-chloro-N-(pyridin-3-yl)indoline-1-carboxamide	DMZ5MDY	Discovery agent	N.A.	Investigative	[63]
5-CT	DM260KD	Discovery agent	N.A.	Investigative	[7]
5-MEO-DMT	DMG0EL7	Discovery agent	N.A.	Investigative	[58]
5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMNRSYA	Discovery agent	N.A.	Investigative	[85]
5-Methoxy-4,9-dihydro-3H-beta-carboline	DMBOMZE	Discovery agent	N.A.	Investigative	[85]
5-METHOXYTRYPTAMINE	DMARCKD	Discovery agent	N.A.	Investigative	[16]
6,7-dichloro-2,3,4,5-tetrahydro-1H-3-benzazepine	DM592FB	Discovery agent	N.A.	Investigative	[86]
6-bromoaplysinopsin	DMQGB70	Discovery agent	N.A.	Investigative	[87]
6-Chloro-1,2,3,4-tetrahydro-pyrazino[1,2-a]indole	DMW6320	Discovery agent	N.A.	Investigative	[57]
6-chloro-N-(pyridin-3-yl)indoline-1-carboxamide	DMUY9TF	Discovery agent	N.A.	Investigative	[63]
6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMSA367	Discovery agent	N.A.	Investigative	[85]
7,8,9,10-tetrahydro-6H-furo-[2,3-g][3]benzazepine	DMIMLUO	Discovery agent	N.A.	Investigative	[86]
7,8,9,10-tetrahydro-6H-furo-[3,2-g][3]benzazepine	DMVZA27	Discovery agent	N.A.	Investigative	[86]
7-Chloro-1,2,3,4-tetrahydro-pyrazino[1,2-a]indole	DMP5JF8	Discovery agent	N.A.	Investigative	[57]
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMQ1BE8	Discovery agent	N.A.	Investigative	[85]
8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline	DMALRU4	Discovery agent	N.A.	Investigative	[85]
8-Bromo-4,9-dihydro-3H-beta-carboline	DM4V5RU	Discovery agent	N.A.	Investigative	[85]
8-Chloro-1,2,3,4-tetrahydro-pyrazino[1,2-a]indole	DMFW6Q0	Discovery agent	N.A.	Investigative	[57]
8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline	DMHE7J5	Discovery agent	N.A.	Investigative	[85]
8-Methoxy-2-(4-methyl-piperazin-1-yl)-quinoline	DMQIFZC	Discovery agent	N.A.	Investigative	[64]
8-Methoxy-2-piperazin-1-yl-quinoline	DMNWC29	Discovery agent	N.A.	Investigative	[64]
8-Methoxy-4,9-dihydro-3H-beta-carboline	DM8MBSN	Discovery agent	N.A.	Investigative	[85]
9-(2-aminoethyl)-9,10-dihydroanthracene	DM4Y9U3	Discovery agent	N.A.	Investigative	[80]
9-(2-aminopropyl)-9,10-dihydroanthracene	DMND39P	Discovery agent	N.A.	Investigative	[80]
9-(Aminomethyl)-9,10-dihydroanthracene	DM6QDNH	Discovery agent	N.A.	Investigative	[75]
9-(N-benzylaminomethyl)-9,10-dihydroanthracene	DMA2RCD	Discovery agent	N.A.	Investigative	[88]
9-OH-risperidone	DMGORXQ	Discovery agent	N.A.	Investigative	[89]
A-987306	DMU34BK	Discovery agent	N.A.	Investigative	[90]
ACP-106	DMBVHLT	Central nervous system disease	8A04-8D87	Investigative	[13]
AL-37350A	DMRJ2GK	Discovery agent	N.A.	Investigative	[91]
alpha-methyl-5-HT	DMCAYXF	Discovery agent	N.A.	Investigative	[92]
ALTANSERIN	DMBGAWI	Discovery agent	N.A.	Investigative	[93]
Aplysinopsin	DMUPL3J	Discovery agent	N.A.	Investigative	[63]
BARETTIN	DMU3D2O	Discovery agent	N.A.	Investigative	[94]
BRL-15572	DMM61Y2	Discovery agent	N.A.	Investigative	[95]
Brolamfetamine	DMC4PF0	Discovery agent	N.A.	Investigative	[96]
bufotenine	DMD1SY9	Discovery agent	N.A.	Investigative	[97]
BW723C86	DME15JU	Discovery agent	N.A.	Investigative	[7]
C-(5-bromo-4,7-dimethoxyindan-1-yl)methylamine	DM0VKFO	Discovery agent	N.A.	Investigative	[76]
C-(5H-Dibenzo[a,d]cyclohepten-5-yl)-methylamine	DMDHVY0	Discovery agent	N.A.	Investigative	[75]
C-(9H-Thioxanthen-9-yl)-methylamine	DMDMA4Z	Discovery agent	N.A.	Investigative	[75]
C-(9H-Xanthen-9-yl)-methylamine	DMN5YOR	Discovery agent	N.A.	Investigative	[75]
CHLOROPHENYLPIPERAZINE	DMOA8L2	Discovery agent	N.A.	Investigative	[98]
CINANSERIN	DM6TJFU	Discovery agent	N.A.	Investigative	[16]
cyamemazine	DMZ6YPV	Discovery agent	N.A.	Investigative	[99]
DOM	DM53KZX	Discovery agent	N.A.	Investigative	[66]
EGIS-7625	DMLK4X5	Discovery agent	N.A.	Investigative	[100]
EPLIVANSERIN MESILATE	DMDOR0L	Discovery agent	N.A.	Investigative	[101]
Etisulergine	DMKH8TC	Discovery agent	N.A.	Investigative	[102]
FLUANISONE	DMQSDM7	Discovery agent	N.A.	Investigative	[103]
ISOCLOZAPINE	DM52CPU	Discovery agent	N.A.	Investigative	[104]
LP-12	DM8ZR17	Discovery agent	N.A.	Investigative	[105]
LP-44	DM0C3SF	Discovery agent	N.A.	Investigative	[105]
LY063518	DMNB82L	Discovery agent	N.A.	Investigative	[106]
LY108742	DMYNCQR	Discovery agent	N.A.	Investigative	[107]
LY215840	DM5RG7J	Discovery agent	N.A.	Investigative	[107]
LY314228	DMWAHYX	Discovery agent	N.A.	Investigative	[106]
LY320954	DM3DOI7	Discovery agent	N.A.	Investigative	[106]
LY433222	DMP8OXG	Depression	6A70-6A7Z	Investigative	[44]
LY86057	DM5TYMG	Discovery agent	N.A.	Investigative	[107]
m-chlorophenylpiperazine	DMM1J2D	Discovery agent	N.A.	Investigative	[108]
MESCALINE	DMYVUCE	Discovery agent	N.A.	Investigative	[66]
METHYLENEDIOXYMETHAMPHETAMINE	DMYVU47	Discovery agent	N.A.	Investigative	[109]
MMDA	DMUWVGP	Discovery agent	N.A.	Investigative	[110]
MPDT	DMYX31S	Discovery agent	N.A.	Investigative	[111]
N,N-dimethyl-2,2-diphenylethanamine	DMJDQGR	Discovery agent	N.A.	Investigative	[80]
N,N-Dimethyl-3,3-diphenylpropan-1-amine	DMIP5K7	Discovery agent	N.A.	Investigative	[80]
N,N-dimethyl-4,4-diphenylbutan-1-amine	DMX9U7S	Discovery agent	N.A.	Investigative	[80]
N-(1-(1-phenylethyl)piperidin-4-yl)-1-naphthamide	DMJWTH9	Discovery agent	N.A.	Investigative	[112]
N-(1-(1-phenylethyl)piperidin-4-yl)-2-naphthamide	DMMCGL3	Discovery agent	N.A.	Investigative	[112]
N-(1-(3-bromobenzyl)piperidin-4-yl)-1-naphthamide	DMGYLC1	Discovery agent	N.A.	Investigative	[113]
N-(1-(3-bromobenzyl)piperidin-4-yl)-2-naphthamide	DMRQKYC	Discovery agent	N.A.	Investigative	[113]
N-(1-(4-bromobenzyl)piperidin-4-yl)-2-naphthamide	DMS9RDW	Discovery agent	N.A.	Investigative	[113]
N-(1-(4-nitrobenzyl)piperidin-4-yl)-2-naphthamide	DMAP4R8	Discovery agent	N.A.	Investigative	[113]
N-(1-(4-phenylbutyl)piperidin-4-yl)-1-naphthamide	DMQSLJI	Discovery agent	N.A.	Investigative	[112]
N-(1-(4-phenylbutyl)piperidin-4-yl)-2-naphthamide	DMZ84JH	Discovery agent	N.A.	Investigative	[112]
N-(1-benzylpiperidine-4-yl)-2-naphthamide	DMUQ6P4	Discovery agent	N.A.	Investigative	[113]
N-(1-phenethylpiperidin-4-yl)-1-naphthamide	DMU9YF6	Discovery agent	N.A.	Investigative	[112]
N-(1-phenethylpiperidin-4-yl)-2-naphthamide	DM9QA7Z	Discovery agent	N.A.	Investigative	[112]
N-1-isopropyl-5-MeOT	DM5LC3D	Discovery agent	N.A.	Investigative	[107]
N-1-isopropyltryptamine	DM25NLH	Discovery agent	N.A.	Investigative	[107]
N-3'-ethylaplysinopsin	DMWZTKD	Discovery agent	N.A.	Investigative	[87]
N-methyl-3,3-diphenylpropan-1-amine	DM8IHQP	Discovery agent	N.A.	Investigative	[80]
N-methyl-4,4-diphenylbutan-1-amine	DMO3PNF	Discovery agent	N.A.	Investigative	[80]
norfluoxetine	DMKNUP3	Discovery agent	N.A.	Investigative	[114]
Org 12962	DM8JUBG	Discovery agent	N.A.	Investigative	[7]
PG-01037	DM2TP4Q	Discovery agent	N.A.	Investigative	[115]
PHENETHYLAMINE	DMX0G4F	Discovery agent	N.A.	Investigative	[75]
PHENYLPIPERAZINE	DMWAK1R	Discovery agent	N.A.	Investigative	[64]
PSILOCIN	DMPDO49	Discovery agent	N.A.	Investigative	[66]
QUIPAZINE	DMPY6IG	Discovery agent	N.A.	Investigative	[116]
Racemic DOI	DM39FSQ	Discovery agent	N.A.	Investigative	[66]
Racemic DOTFM	DMNLCUH	Discovery agent	N.A.	Investigative	[66]
SB 215505	DMCM4LT	Discovery agent	N.A.	Investigative	[117]
SB 216641	DMB3R4Z	Discovery agent	N.A.	Investigative	[95]
SB 221284	DM8DVY2	Discovery agent	N.A.	Investigative	[7]
SB 228357	DMKA8R4	Discovery agent	N.A.	Investigative	[118]
SB 242084	DMISBDC	Discovery agent	N.A.	Investigative	[119]
SB-271046	DM5VJAF	Discovery agent	N.A.	Investigative	[120]
SEL-73	DMFKE6C	Psychiatric disorder	6E8Z	Investigative	[13]
SEROTONIN	DMOFCRY	Discovery agent	N.A.	Investigative	[116]
spiramide	DM5KNMD	Discovery agent	N.A.	Investigative	[7]
TFMPP	DMAC8TP	Discovery agent	N.A.	Investigative	[7]
TRYPTOLINE	DMV19K7	Discovery agent	N.A.	Investigative	[85]
VER-2692	DM5WAM8	Discovery agent	N.A.	Investigative	[121]
VER-3323	DM7O2K1	Discovery agent	N.A.	Investigative	[122]
VER-5384	DMC2EO9	Discovery agent	N.A.	Investigative	[122]
VER-5593	DMZ2V0A	Discovery agent	N.A.	Investigative	[122]
Very low dose (VLD) cyclobenzaprine	DMUHEJ3	Fibromyalgia	MG30.01	Investigative	[13]
WAY-208466	DM9K2LU	Discovery agent	N.A.	Investigative	[123]
YM-348	DM38F9T	Discovery agent	N.A.	Investigative	[86]
[11C]volinanserin	DMCQTYW	Discovery agent	N.A.	Investigative	[124]
[125I]DOI	DMQUY08	Discovery agent	N.A.	Investigative	[125]
[18F]altanserin	DM65BDN	Discovery agent	N.A.	Investigative	[126]
[2-(4-Fluoro-1H-indol-3-yl)-ethyl]-dimethyl-amine	DMDIH96	Discovery agent	N.A.	Investigative	[71]
[2-(6-Methoxy-indol-1-yl)-ethyl]-dimethyl-amine	DMHPBQC	Discovery agent	N.A.	Investigative	[57]
[3H]N-methylspiperone	DM5176Y	Discovery agent	N.A.	Investigative	[92]
[3H]spiperone	DMWHEV8	Discovery agent	N.A.	Investigative	[127]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Schizophrenia	6A20	Pre-frontal cortex	1.68E-01	-0.3	-0.14
Schizophrenia	6A20	Superior temporal cortex	5.59E-01	0.15	0.21
Major depressive disorder	6A20	Pre-frontal cortex	4.32E-01	0.15	0.13
Bipolar disorder	6A20	Pre-frontal cortex	7.61E-01	-0.65	-0.54

References

• [1] Beneficial effects of sarpogrelate hydrochloride, a 5-HT2A receptor antagonist, supplemented with pioglitazone on diabetic model mice. Endocr Res. 2009;34(1-2):18-30.
• [2] Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43.
• [3] Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651.
• [4] Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
• [5] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
• [6] Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5.
• [7] Pharmacological characterisation of the agonist radioligand binding site of 5-HT(2A), 5-HT(2B) and 5-HT(2C) receptors. Naunyn Schmiedebergs Arch Pharmacol. 2004 Aug;370(2):114-23.
• [8] Pimavanserin, a selective serotonin (5-HT)2A-inverse agonist, enhances the efficacy and safety of risperidone, 2mg/day, but does not enhance efficacy of haloperidol, 2mg/day: comparison with reference dose risperidone, 6mg/day.Schizophr Res.2012 Nov;141(2-3):144-52.
• [9] Current and novel approaches to the drug treatment of schizophrenia. J Med Chem. 2001 Feb 15;44(4):477-501.
• [10] The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22.
• [11] Clinical pipeline report, company report or official report of Intra-Cellular Therapies, Inc.
• [12] Antagonism of 5-hydroxytryptamine(2a) receptors attenuates the behavioral effects of cocaine in rats. J Pharmacol Exp Ther. 2001 Apr;297(1):357-63.
• [13] Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59.
• [14] SR46349-B, a 5-HT(2A/2C) receptor antagonist, potentiates haloperidol-induced dopamine release in rat medial prefrontal cortex and nucleus accumbens. Neuropsychopharmacology. 2002 Sep;27(3):430-41.
• [15] Clinical pipeline report, company report or official report of Tonix Pharmaceuticals.
• [16] Central serotonin receptors as targets for drug research. J Med Chem. 1987 Jan;30(1):1-12.
• [17] Clinical pipeline report, company report or official report of Lundbeck.
• [18] Novel ocular antihypertensive compounds in clinical trials. Clin Ophthalmol. 2011; 5: 667-677.
• [19] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [20] Nelotanserin, a novel selective human 5-hydroxytryptamine2A inverse agonist for the treatment of insomnia.J Pharmacol Exp Ther.2010 Jan;332(1):281-90.
• [21] The neuropharmacology of sleep paralysis hallucinations: serotonin 2A activation and a novel therapeutic drug. Psychopharmacology (Berl). 2018 Nov;235(11):3083-3091.
• [22] 5-HT(2A) inverse-agonists for the treatment of insomnia. Curr Top Med Chem. 2008;8(11):969-76.
• [23] Therapeutic strategies for Parkinson disease: beyond dopaminergic drugs. Nat Rev Drug Discov. 2018 Nov;17(11):804-822.
• [24] 7-[3-(1-piperidinyl)propoxy]chromenones as potential atypical antipsychotics. 2. Pharmacological profile of 7-[3-[4-(6-fluoro-1, 2-benzisoxazol-3-yl)-piperidin-1-yl]propoxy]-3-(hydroxymeth yl)chromen -4-one (abaperidone, FI-8602). J Med Chem. 1998 Dec 31;41(27):5402-9.
• [25] Pharmacological characteristics of ATI-9242, a Novel Atypical Antipsychotic. FASEB J, April, 2010, 24(Meeting Abstract Supplement),773.12.
• [26] Bi-directional modulation of BNST neurons by 5-HT: Molecular expression and functional properties of excitatory 5-HT receptor subtypes. Neuroscience. 2009 December 29; 164(4): 1776-1793.
• [27] Clinical pipeline report, company report or official report of Arena Pharmaceuticals.
• [28] Modeling of brain D2 receptor occupancy-plasma concentration relationships with a novel antipsychotic, YKP1358, using serial PET scans in healthy volunteers. Clin Pharmacol Ther. 2007 Feb;81(2):252-8.
• [29] Novel serotonin receptor 2 (5-HT2R) agonists and antagonists: a patent review (2004-2014).Expert Opin Ther Pat. 2016;26(1):89-106.
• [30] 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689.
• [31] C-(4,5,6-trimethoxyindan-1-yl)methanamine: a mescaline analogue designed using a homology model of the 5-HT2A receptor. J Med Chem. 2006 Jul 13;49(14):4269-74.
• [32] Deramciclane, a putative anxiolytic drug, is a serotonin 5-HT2C receptor inverse agonist but fails to induce 5-HT2C receptor down-regulation. Psychopharmacology (Berl). 1998 Mar;136(2):99-104.
• [33] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 6).
• [34] Ketanserin analogues: structure-affinity relationships for 5-HT2 and 5-HT1C serotonin receptor binding. J Med Chem. 1992 Dec 25;35(26):4903-10.
• [35] Characterization of contractile 5-hydroxytryptamine receptor subtypes in the in situ autoperfused kidney in the anaesthetized rat. Eur J Pharmacol. 2008 Sep 11;592(1-3):133-7.
• [36] 3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents. J Med Chem. 1996 Jan 5;39(1):143-8.
• [37] Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92.
• [38] Effects of the serotonin antagonist amesergide on reproduction in female rats. Reprod Toxicol. 1993 Nov-Dec;7(6):607-12.
• [39] Mechanism of the antihypertensive effect of FCE 22716, a new ergoline derivative, in the spontaneously hypertensive rat. Pharmacology. 1989;38(2):78-92.
• [40] A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2.
• [41] Serotonergic (5-HT2) mediation of anxiety-therapeutic effects of serazepine in generalized anxiety disorder. Biol Psychiatry. 1993 Jul 1-15;34(1-2):41-4.
• [42] 5-Hydroxytryptamine2 receptor antagonist activity of the acid metabolite (1-isopropyl dihydrolysergic acid) of the ergoline ester, sergolexole (LY281067). J Pharmacol Exp Ther. 1989 Dec;251(3):1006-11.
• [43] Antiplatelet and antithrombotic activity of SL65.0472, a mixed 5-HT1B/5-HT2A receptor antagonist.Thromb Haemost.2001 Mar;85(3):521-8.
• [44] Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23.
• [45] Clinical pipeline report, company report or official report of Avarx.
• [46] Piperidinyltetralin sigma ligands. J Med Chem. 1994 Feb 4;37(3):364-70.
• [47] Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43.
• [48] Action of the 5-HT2A antagonist amperozide on alcohol-induced poikilothermia in rats. Pharmacol Biochem Behav. 1998 Jan;59(1):91-5.
• [49] Vascular and cardiac effects of DV-7028, a selective, 5-HT2-receptor antagonist in rats. J Cardiovasc Pharmacol. 1998 Aug;32(2):266-73.
• [50] Autoradiographic studies of RP 62203, a potent 5-HT2 receptor antagonist. Pharmacological characterization of [3H]RP 62203 binding in the rat brain. Eur J Pharmacol. 1993 Mar 16;233(1):37-45.
• [51] Serotonin 5-HT(2A) receptor antagonists in the treatment of insomnia: present status and future prospects.Drugs Today (Barc).2010 Mar;46(3):183-93.
• [52] The 5-hydroxytryptamine2A receptor is involved in (+)-norfenfluramine-induced arterial contraction and blood pressure increase in deoxycorticostero... J Pharmacol Exp Ther. 2007 May;321(2):485-91.
• [53] Effects of R-102444 and its active metabolite R-96544, selective 5-HT2A receptor antagonists, on experimental acute and chronic pancreatitis: Additional evidence for possible involvement of 5-HT2A receptors in the development of experimental pancreatitis.Eur J Pharmacol.2005 Oct 3;521(1-3):156-63.
• [54] Synthesis and structure-activity relationships of a series of substituted 2-(1H-furo[2,3-g]indazol-1-yl)ethylamine derivatives as 5-HT2C receptor a... Bioorg Med Chem. 2008 Feb 15;16(4):1966-82.
• [55] New indole derivatives as potent and selective serotonin uptake inhibitors. J Med Chem. 1993 Apr 30;36(9):1194-202.
• [56] Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31.
• [57] Evaluation of isotryptamine derivatives at 5-HT(2) serotonin receptors. Bioorg Med Chem Lett. 2002 Jan 21;12(2):155-8.
• [58] 1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. J Med Chem. 2006 Jan 12;49(1):318-28.
• [59] 2,5-Disubstituted pyridines: the discovery of a novel series of 5-HT2A ligands. Bioorg Med Chem Lett. 2007 May 1;17(9):2643-8.
• [60] N-Propylnoraporphin-11-O-yl carboxylic esters as potent dopamine D(2) and serotonin 5-HT(1A) receptor dual ligands. Bioorg Med Chem. 2008 Sep 15;16(18):8335-8.
• [61] Novel benzodifuran analogs as potent 5-HT2A receptor agonists with ocular hypotensive activity. Bioorg Med Chem Lett. 2007 Jun 1;17(11):2998-3002.
• [62] Design and synthesis of a functionally selective D3 agonist and its in vivo delivery via the intranasal route. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6691-6.
• [63] Synthesis and structure-affinity relationships of novel small molecule natural product derivatives capable of discriminating between serotonin 5-HT1A, 5-HT2A, 5-HT2C receptor subtypes. Bioorg Med Chem. 2010 Jul 1;18(13):4783-92.
• [64] 5-HT1 and 5-HT2 binding characteristics of some quipazine analogues. J Med Chem. 1986 Nov;29(11):2375-80.
• [65] Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. J Med Chem. 2010 Jun 24;53(12):4803-7.
• [66] The role of lipophilicity in determining binding affinity and functional activity for 5-HT2A receptor ligands. Bioorg Med Chem. 2008 Apr 15;16(8):4661-9.
• [67] Synthesis and evaluation of phenyl- and benzoylpiperazines as potential serotonergic agents. J Med Chem. 1986 May;29(5):630-4.
• [68] Structure-activity relationship studies of central nervous system agents. 13. 4-[3-(Benzotriazol-1-yl)propyl]-1-(2-methoxyphenyl)piperazine, a new ... J Med Chem. 1994 Aug 19;37(17):2754-60.
• [69] The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. Bioorg Med Chem. 2007 Nov 1;15(21):6659-66.
• [70] Synthesis and QSAR studies on hypotensive 1-[3-(4-substituted phenylthio) propyl]-4-(substituted phenyl) piperazines. Bioorg Med Chem Lett. 2007 Mar 15;17(6):1708-12.
• [71] SAR of psilocybin analogs: discovery of a selective 5-HT 2C agonist. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4555-9.
• [72] Methoxy-substituted 9-aminomethyl-9,10-dihydroanthracene (AMDA) derivatives exhibit differential binding affinities at the 5-HT(2A) receptor. Bioorg Med Chem Lett. 2008 Oct 1;18(19):5268-71.
• [73] Influence of the terminal amide fragment geometry in some 3-arylideneindolin-2(1H)-ones on their 5-HT1A/5-HT2A receptor activity. Bioorg Med Chem Lett. 2001 May 7;11(9):1229-31.
• [74] Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997).
• [75] Exploring the relationship between binding modes of 9-(aminomethyl)-9,10-dihydroanthracene and cyproheptadine analogues at the 5-HT2A serotonin rec... Bioorg Med Chem Lett. 2001 Feb 26;11(4):563-6.
• [76] 1-Aminomethylbenzocycloalkanes: conformationally restricted hallucinogenic phenethylamine analogues as functionally selective 5-HT2A receptor agoni... J Med Chem. 2006 Sep 21;49(19):5794-803.
• [77] Dose-response study of N,N-dimethyltryptamine in humans. I. Neuroendocrine, autonomic, and cardiovascular effects. Arch Gen Psychiatry. 1994 Feb;51(2):85-97.
• [78] 5-HT1 and 5-HT2 binding characteristics of 1-(2,5-dimethoxy-4-bromophenyl)-2-aminopropane analogues. J Med Chem. 1986 Feb;29(2):194-9.
• [79] 4-(3-furyl)-2-(4-methylpiperazino)pyrimidines: Potent 5-HT2A receptor antagonists, Bioorg. Med. Chem. Lett. 7(13):1635-1638 (1997).
• [80] Synthesis, structure-affinity relationships, and modeling of AMDA analogs at 5-HT2A and H1 receptors: structural factors contributing to selectivity. Bioorg Med Chem. 2009 Sep 15;17(18):6496-504.
• [81] Design and synthesis of orally-active and selective azaindane 5HT2c agonist for the treatment of obesity. Bioorg Med Chem Lett. 2010 Jan 1;20(1):266-71.
• [82] 3-(4-Piperidinyl)- and 3-(8-aza-bicyclo[3.2.1]oct-3-yl)-2-phenyl-1H-indoles as bioavailable h5-HT2A antagonists. Bioorg Med Chem Lett. 2000 Dec 18;10(24):2701-3.
• [83] Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
• [84] Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61.
• [85] Binding of beta-carbolines at 5-HT(2) serotonin receptors. Bioorg Med Chem Lett. 2003 Dec 15;13(24):4421-5.
• [86] Synthesis and structure-activity relationships of a series of benzazepine derivatives as 5-HT2C receptor agonists. Bioorg Med Chem. 2008 Mar 15;16(6):3309-20.
• [87] New antiinfective and human 5-HT2 receptor binding natural and semisynthetic compounds from the Jamaican sponge Smenospongia aurea. J Nat Prod. 2002 Apr;65(4):476-80.
• [88] 9-Aminomethyl-9,10-dihydroanthracene (AMDA) analogs as structural probes for steric tolerance in 5-HT2A and H1 receptor binding sites. Bioorg Med Chem Lett. 2010 Feb 1;20(3):935-8.
• [89] Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73.
• [90] cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8.
• [91] A novel and selective 5-HT2 receptor agonist with ocular hypotensive activity: (S)-(+)-1-(2-aminopropyl)-8,9-dihydropyrano[3,2-e]indole. J Med Chem. 2003 Sep 11;46(19):4188-95.
• [92] Differential modes of agonist binding to 5-hydroxytryptamine(2A) serotonin receptors revealed by mutation and molecular modeling of conserved residues in transmembrane region 5. Mol Pharmacol. 2000 Nov;58(5):877-86.
• [93] Synthesis and in vitro affinities of various MDL 100907 derivatives as potential 18F-radioligands for 5-HT2A receptor imaging with PET. Bioorg Med Chem. 2009 Apr 15;17(8):2989-3002.
• [94] Brominated cyclodipeptides from the marine sponge Geodia barretti as selective 5-HT ligands. J Nat Prod. 2006 Oct;69(10):1421-4.
• [95] SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20.
• [96] 'Hybrid' benzofuran-benzopyran congeners as rigid analogs of hallucinogenic phenethylamines. Bioorg Med Chem. 2008 Jun 1;16(11):6242-51.
• [97] Mapping the binding site pocket of the serotonin 5-Hydroxytryptamine2A receptor. Ser3.36(159) provides a second interaction site for the protonated amine of serotonin but not of lysergic acid diethylamide or bufotenin. J Biol Chem. 1996 Jun 21;271(25):14672-5.
• [98] Tricyclic dihydroquinazolinones as novel 5-HT2C selective and orally efficacious anti-obesity agents. Bioorg Med Chem Lett. 2010 Feb 1;20(3):1128-33.
• [99] Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40.
• [100] Effects of EGIS-7625, a selective and competitive 5-HT2B receptor antagonist. Cardiovasc Drugs Ther. 2003 Sep-Nov;17(5-6):427-34.
• [101] Role of 5-HT2A receptor antagonists in the treatment of insomnia
• [102] Resolution and absolute configuration of the potent dopamine agonist N,N-diethyl-N'-[(3 alpha, 4a alpha, 10a beta)-1,2,3,4,4a,5,10,10a- -octahydro-... J Med Chem. 1985 Oct;28(10):1540-2.
• [103] 2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1. J Med Chem. 1987 Nov;30(11):2099-104.
• [104] Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. J Med Chem. 1997 Dec 5;40(25):4146-53.
• [105] Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21.
• [106] A novel class of 5-HT2A receptor antagonists: aryl aminoguanidines. Life Sci. 1996;59(15):1259-68.
• [107] Species variations in transmembrane region V of the 5-hydroxytryptamine type 2A receptor alter the structure-activity relationship of certain ergolines and tryptamines. Mol Pharmacol. 1994 Feb;45(2):277-86.
• [108] Comparisons of hallucinogenic phenylisopropylamine binding affinities at cloned human 5-HT2A, -HT(2B) and 5-HT2C receptors. Naunyn Schmiedebergs Arch Pharmacol. 1999 Jan;359(1):1-6.
• [109] The origin of MDMA (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5.
• [110] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [111] 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8.
• [112] Synthesis and in vitro binding studies of substituted piperidine naphthamides. Part I: Influence of the substitution on the basic nitrogen and the ... Bioorg Med Chem Lett. 2007 Mar 15;17(6):1565-9.
• [113] Synthesis and in vitro binding studies of substituted piperidine naphthamides. Part II: Influence of the substitution on the benzyl moiety on the a... Bioorg Med Chem Lett. 2007 Mar 15;17(6):1570-4.
• [114] Evidence for possible involvement of 5-HT(2B) receptors in the cardiac valvulopathy associated with fenfluramine and other serotonergic medications. Circulation. 2000 Dec 5;102(23):2836-41.
• [115] Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3... J Med Chem. 2007 Aug 23;50(17):4135-46.
• [116] Novel, potent, and selective quinoxaline-based 5-HT(3) receptor ligands. 1. Further structure-activity relationships and pharmacological characteri... J Med Chem. 2009 Nov 12;52(21):6946-50.
• [117] Attenuation of haloperidol-induced catalepsy by a 5-HT2C receptor antagonist. Br J Pharmacol. 1999 Feb;126(3):572-4.
• [118] Biarylcarbamoylindolines are novel and selective 5-HT(2C) receptor inverse agonists: identification of 5-methyl-1-[[2-[(2-methyl-3-pyridyl)oxy]- 5-pyridyl]carbamoyl]-6-trifluoromethylindoline (SB-243213) as a potential antidepressant/anxiolytic agent. J Med Chem. 2000 Mar 23;43(6):1123-34.
• [119] SB 242084, a selective and brain penetrant 5-HT2C receptor antagonist. Neuropharmacology. 1997 Apr-May;36(4-5):609-20.
• [120] Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43.
• [121] Pyrrolo(iso)quinoline derivatives as 5-HT(2C) receptor agonists. Bioorg Med Chem Lett. 2006 Feb;16(3):677-80.
• [122] Indoline derivatives as 5-HT(2C) receptor agonists. Bioorg Med Chem Lett. 2004 May 3;14(9):2367-70.
• [123] Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. Bioorg Med Chem. 2009 Jul 15;17(14):5153-63.
• [124] Autoradiographic localization of 5-HT(2A) receptors in the human brain using [(3)H]M100907 and [(11)C]M100907. Synapse. 2000 Dec 15;38(4):421-31.
• [125] Effect of ring fluorination on the pharmacology of hallucinogenic tryptamines. J Med Chem. 2000 Nov 30;43(24):4701-10.
• [126] Visualisation of loss of 5-HT2A receptors with age in healthy volunteers using [18F]altanserin and positron emission tomographic imaging. Psychiatry Res. 1996 Nov 25;68(1):11-22.
• [127] Activity of Parthenolide at 5HT2A receptors. J Nat Prod. 1997 Jun;60(6):651-3.