Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTSZLWK)

DTT Name Aromatase (CYP19A1)
Synonyms P-450AROM; Estrogen synthetase; Estrogen synthase; Cytochrome P450 19A1; Cytochrome P-450AROM; CYPXIX; CYP19; CYAR; ARO1
Gene Name CYP19A1
DTT Type
Successful target
 [1]
Related Disease
Breast cancer [ICD-11: 2C60-2C6Y]
Cushing syndrome [ICD-11: 5A70]
BioChemical Class
Paired donor oxygen oxidoreductase
UniProt ID
CP19A_HUMAN
TTD ID
T13260
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 1.14.14.14
Sequence
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
Function Catalyzes the formation of aromatic C18 estrogens from C19 androgens.
KEGG Pathway
Steroid hormone biosynthesis (hsa00140 )
Metabolic pathways (hsa01100 )
Ovarian steroidogenesis (hsa04913 )
Reactome Pathway
Endogenous sterols (R-HSA-211976 )
BioCyc Pathway
MetaCyc:HS06413-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
6 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Aminoglutethimide DMWFHMZ Cushing disease 5A70 Approved [1]
Anastrozole DMNP60F Breast cancer 2C60-2C65 Approved [2], [3]
Exemestane DM9HPW3 Hormonally-responsive breast cancer 2C60-2C65 Approved [4]
FADROZOLE DM3C5GZ Breast cancer 2C60-2C65 Approved [5]
Letrozole DMH07Y3 Hormonally-responsive breast cancer 2C60-2C65 Approved [4]
Testolactone DMVY4GN Breast cancer 2C60-2C65 Approved [3], [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Approved Drug(s)
6 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Atamestane + Toremifene DM3QLK2 Breast cancer 2C60-2C65 Phase 3 [7]
LIAROZOLE DM4OYXE Dermatological disease DA24.Y Phase 2/3 [8]
BGS-649 DMO4MNQ Endometriosis GA10 Phase 2 [9]
Coumate DMVKW0N Breast cancer 2C60-2C65 Phase 2 [10]
Dextromethorphan+quinidine DMFI5J4 Diabetic neuropathy 8C0Z Phase 2 [11]
Naringenin DMHAZLM N. A. N. A. Phase 1 [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Clinical Trial Drug(s)
7 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
FORMESTANE DMWIDJK Breast cancer 2C60-2C65 Withdrawn from market [12]
FINROZOLE DM06SC9 Prostate disease GA91 Discontinued in Phase 2 [13], [14]
NKS-01 DMV5FN1 Bladder cancer 2C94 Discontinued in Phase 2 [15], [14]
VOROZOLE DM32N5G N. A. N. A. Discontinued in Phase 2 [16]
YM-511 DM7WDAG Breast cancer 2C60-2C65 Discontinued in Phase 2 [17]
MINAMESTANE DM7IXH3 Bladder cancer 2C94 Terminated [18], [14]
Rogletimide DM6JO30 Breast cancer 2C60-2C65 Terminated [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Discontinued Drug(s)
220 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(+/-)-7-methoxy-2-(4-methoxyphenyl)chroman-4-one DMYJGDK Discovery agent N.A. Investigative [20]
(+/-)-7-methoxy-2-phenylchroman-4-one DMC0OKA Discovery agent N.A. Investigative [21]
(2S)-5,7,2',4'-tetrahydroxyflavanone DMYVBHT Discovery agent N.A. Investigative [22]
(2S)-abyssinone II DM5V3M1 Discovery agent N.A. Investigative [22]
(2S)-euchrenone a7 DM6L0KZ Discovery agent N.A. Investigative [22]
1-(1-Benzyl-2-biphenyl-4-yl-ethyl)-1H-imidazole DMLBCE5 Discovery agent N.A. Investigative [23]
1-(2-(benzo[b]thiophen-4-yl)ethyl)-1H-imidazole DMB3HI4 Discovery agent N.A. Investigative [24]
1-(2-phenoxybenzyl)-1H-imidazole DMLY4ER Discovery agent N.A. Investigative [25]
1-(3-(4-fluorophenyl)propyl)-1H-imidazole DMWKXZ2 Discovery agent N.A. Investigative [8]
1-(3-Methoxy-naphthalen-2-yl)-1H-imidazole DM16U5F Discovery agent N.A. Investigative [26]
1-(4-Aminophenyl)-2-(1H-imidazol-1-yl)ethanone DMMYT4W Discovery agent N.A. Investigative [27]
1-(4-Cyanobenzyl)-5-methyl-1H-imidazole DMKC52N Discovery agent N.A. Investigative [28]
1-(4-nitro-2-phenoxybenzyl)-1H-imidazole DMSRBUE Discovery agent N.A. Investigative [25]
1-(4-Nitro-2-phenylsulfanylbenzyl)-1H-imidazole DMCP089 Discovery agent N.A. Investigative [25]
1-(7-Methoxy-2-phenyl-chroman-4-yl)-1H-imidazole DMLHDE3 Discovery agent N.A. Investigative [29]
1-(9-phenyl-9H-fluoren-9-yl)-1H-1,2,4-triazole DMVJZ0C Discovery agent N.A. Investigative [24]
1-(9-Phenyl-9H-fluoren-9-yl)1H-imidazole DMLIJYS Discovery agent N.A. Investigative [8]
1-(9H-fluoren-9-yl)-1H-imidazole DMH49OD Discovery agent N.A. Investigative [24]
1-(biphenyl-3-ylmethyl)-1H-1,2,4-triazole DMGVPMT Discovery agent N.A. Investigative [10]
1-Bromo-4-imidazol-1-ylmethyl-xanthen-9-one DMGL4MJ Discovery agent N.A. Investigative [30]
1-Ethyl-5-(imidazol-1-yl-phenyl-methyl)-1H-indole DMUOSJG Discovery agent N.A. Investigative [31]
1-Imidazol-1-ylmethyl-4-nitro-xanthen-9-one DMN7KHS Discovery agent N.A. Investigative [30]
1-Imidazol-1-ylmethylxanthen-9-one DMIDX7P Discovery agent N.A. Investigative [25]
1-Naphthalen-2-yl-1H-imidazole DMTBZJL Discovery agent N.A. Investigative [26]
1-[(7-Fluoronaphth-2-yl)methyl]-1H-imidazole DMNJMGK Discovery agent N.A. Investigative [8]
10-EPI-8-DEOXY-CUMAMBRIN B DMDQ7Z9 Discovery agent N.A. Investigative [8]
11BETA,13-DIHYDRO-10-EPI-8-DEOXYCUMAM-BRIN B DM0EPJT Discovery agent N.A. Investigative [8]
2,3,4-Trimethoxy-4'-amino-trans-stilbene DMPRF1X Discovery agent N.A. Investigative [27]
2,3,5-Trimethoxy-4'-amino-trans-stilbene DMLI5UT Discovery agent N.A. Investigative [27]
2,3-Dimethoxy-4'-amino-trans-stilbene DM9C0YZ Discovery agent N.A. Investigative [27]
2,4-Dimethoxy-3'-amino-trans-stilbene DMHSLXI Discovery agent N.A. Investigative [27]
2,4-Dimethoxy-4'-amino-trans-stilbene DMMZ643 Discovery agent N.A. Investigative [27]
2,5-Dimethoxy-4'-amino-trans-stilbene DMV0UIR Discovery agent N.A. Investigative [27]
2-(1H-Imidazol-1-yl)-1-(4-nitrophenyl)ethanone DMFK9GA Discovery agent N.A. Investigative [27]
2-(3-hydroxyphenyl)-7-methoxychroman-4-one DMAH0ZG Discovery agent N.A. Investigative [21]
2-(4-hydroxyphenyl)-7-methoxychroman-4-one DMT847Y Discovery agent N.A. Investigative [21]
2-Imidazol-1-yl-7-methoxy-3-phenyl-chromen-4-one DM261B0 Discovery agent N.A. Investigative [32]
2-Imidazol-1-ylmethylxanthen-9-one DM2GUDZ Discovery agent N.A. Investigative [25]
2-phenyl-2,3-dihydrobenzo[h]chromen-4-one DMRNZ4X Discovery agent N.A. Investigative [21]
2-Phenyl-3-pyridin-4-ylmethylene-chroman-4-one DMKCOS2 Discovery agent N.A. Investigative [33]
2-Phenyl-4-[1,2,4]triazol-1-yl-chroman-7-ol DMEXYSP Discovery agent N.A. Investigative [29]
3,4'-(Ethane-1,2-diyl)dibenzenamine DMFM60H Discovery agent N.A. Investigative [27]
3,4,5-Trimethoxy-3'-amino-trans-stilbene DMCA7XU Discovery agent N.A. Investigative [27]
3,4,5-Trimethoxy-4'-amino-trans-stilbene DMDBOJ5 Discovery agent N.A. Investigative [27]
3,4-bis(3,4-dimethoxyphenyl)furan-2(5H)-one DM91W2K Discovery agent N.A. Investigative [8]
3,4-Dimethoxy-4'-amino-trans-stilbene DMVDZCE Discovery agent N.A. Investigative [27]
3,5-Diacetoxy-4'-amino-trans-stilbene DMEXPIJ Discovery agent N.A. Investigative [27]
3,5-Diamino-4'-amino-trans-stilbene DMK9JCA Discovery agent N.A. Investigative [27]
3,5-Dihydroxyl-4'-amino-trans-stilbene DMQ9TNB Discovery agent N.A. Investigative [27]
3,5-Dimethoxy-4'-amino-trans-stilbene DMC3917 Discovery agent N.A. Investigative [27]
3-((1H-imidazol-1-yl)methyl)-9H-xanthen-9-one DM491YV Discovery agent N.A. Investigative [25]
3-(1-ethyl-3,4-dihydronaphthalen-2-yl)-pyridine DMR7M82 Discovery agent N.A. Investigative [34]
3-(1-methyl-3,4-dihydronaphthalen-2-yl)-pyridine DMU5HMC Discovery agent N.A. Investigative [34]
3-(2,2-Diphenyl-vinyl)-pyridine DMCPOQ9 Discovery agent N.A. Investigative [35]
3-(3,4-dihydronaphthalen-2-yl)pyridine DM0VL17 Discovery agent N.A. Investigative [34]
3-(3-methyl-3,4-dihydronaphthalen-2-yl)pyridine DM2YLBD Discovery agent N.A. Investigative [34]
3-(4-Amino-phenyl)-1-methyl-pyrrolidine-2,5-dione DMS1LDH Discovery agent N.A. Investigative [36]
3-(4-Amino-phenyl)-3-butyl-piperidine-2,6-dione DMD5YKO Discovery agent N.A. Investigative [37]
3-(4-Amino-phenyl)-3-ethyl-pyrrolidine-2,5-dione DM3I15D Discovery agent N.A. Investigative [36]
3-(4-Amino-phenyl)-3-heptyl-piperidine-2,6-dione DMZ86CS Discovery agent N.A. Investigative [37]
3-(4-Amino-phenyl)-3-hexyl-piperidine-2,6-dione DMW62U8 Discovery agent N.A. Investigative [37]
3-(4-Amino-phenyl)-3-methyl-pyrrolidine-2,5-dione DMITHX5 Discovery agent N.A. Investigative [36]
3-(4-Amino-phenyl)-3-pentyl-piperidine-2,6-dione DM20DXS Discovery agent N.A. Investigative [37]
3-(4-Amino-phenyl)-3-propyl-piperidine-2,6-dione DM39XMT Discovery agent N.A. Investigative [37]
3-(4-Amino-phenyl)-pyrrolidine-2,5-dione DMVN0O5 Discovery agent N.A. Investigative [36]
3-(4-methyl-3,4-dihydronaphthalen-2-yl)pyridine DMDR20P Discovery agent N.A. Investigative [34]
3-(5-Bromo-6-methoxy-naphthalen-2-yl)-pyridine DMUIXNS Discovery agent N.A. Investigative [26]
3-(5-Chloro-6-methoxy-naphthalen-2-yl)-pyridine DM67DVU Discovery agent N.A. Investigative [26]
3-(6-Ethoxy-naphthalen-2-yl)-pyridine DMUQ0WI Discovery agent N.A. Investigative [26]
3-(6-methoxy-3,4-dihydronaphthalen-2-yl)pyridine DMAJHXO Discovery agent N.A. Investigative [34]
3-(6-methoxynaphthalen-2-yl)pyridine DMYRJAB Discovery agent N.A. Investigative [38]
3-(imidazolylmethyl)-4'-methoxyflavone DMM52LC Discovery agent N.A. Investigative [39]
3-(imidazolylmethyl)-4'-nitroflavone DMX2LT5 Discovery agent N.A. Investigative [39]
3-(imidazolylmethyl)-7-methoxy-4'-nitroflavone DML63MX Discovery agent N.A. Investigative [39]
3-(imidazolylmethyl)flavone DMLI7F4 Discovery agent N.A. Investigative [39]
3-(naphthalen-2-yl)pyridine DMJRBT1 Discovery agent N.A. Investigative [38]
3-Amino-4'-amino-trans-stilbene DMIS3LN Discovery agent N.A. Investigative [27]
3-Fluoren-9-ylidenemethyl-pyridine DMR29IQ Discovery agent N.A. Investigative [35]
3-Fluoro-4'-(pyridin-4-ylmethyl)biphenyl-4-ol DMJ3WNP Discovery agent N.A. Investigative [40]
3-Indan-(1E)-ylidenemethyl-pyridine DMYH6A2 Discovery agent N.A. Investigative [35]
3-Indan-(1Z)-ylidenemethyl-pyridine DMTQERW Discovery agent N.A. Investigative [35]
3-Methoxyl-4'-amino-trans-stilbene DMWNO4D Discovery agent N.A. Investigative [27]
3-Nitro-4'-nitro-trans-stilbene DMZRNOT Discovery agent N.A. Investigative [27]
3-[3-Methyl-indan-(1E)-ylidenemethyl]-pyridine DMDS8UJ Discovery agent N.A. Investigative [35]
3-[3-Methyl-indan-(1Z)-ylidenemethyl]-pyridine DMTF520 Discovery agent N.A. Investigative [35]
3-[3-Phenyl-indan-(1E)-ylidenemethyl]-pyridine DMYEWA4 Discovery agent N.A. Investigative [35]
3-[4-Chloro-indan-(1E)-ylidenemethyl]-pyridine DM0XD6T Discovery agent N.A. Investigative [35]
3-[4-Chloro-indan-(1Z)-ylidenemethyl]-pyridine DMMDIB9 Discovery agent N.A. Investigative [35]
3-[4-Fluoro-indan-(1E)-ylidenemethyl]-pyridine DMZS20Y Discovery agent N.A. Investigative [35]
3-[4-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine DMPS340 Discovery agent N.A. Investigative [35]
3-[4-Methyl-indan-(1E)-ylidenemethyl]-pyridine DMJN93U Discovery agent N.A. Investigative [35]
3-[4-Methyl-indan-(1Z)-ylidenemethyl]-pyridine DMNILXG Discovery agent N.A. Investigative [35]
3-[5-Bromo-indan-(1E)-ylidenemethyl]-pyridine DMUEVAQ Discovery agent N.A. Investigative [35]
3-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine DMCXSIH Discovery agent N.A. Investigative [35]
3-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine DM8TWLO Discovery agent N.A. Investigative [35]
3-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine DMN60YG Discovery agent N.A. Investigative [35]
3-[5-Ethoxy-indan-(1E)-ylidenemethyl]-pyridine DMLJQZS Discovery agent N.A. Investigative [35]
3-[5-Ethoxy-indan-(1Z)-ylidenemethyl]-pyridine DMMTUON Discovery agent N.A. Investigative [35]
3-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine DMWSFIR Discovery agent N.A. Investigative [35]
3-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine DMN42I5 Discovery agent N.A. Investigative [35]
3-[5-Methoxy-indan-(1E)-ylidenemethyl]-pyridine DM9AW5U Discovery agent N.A. Investigative [35]
3-[5-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine DMB3XYE Discovery agent N.A. Investigative [35]
3-[6-Methoxy-indan-(1E)-ylidenemethyl]-pyridine DMHT6FX Discovery agent N.A. Investigative [35]
3-[6-Methyl-indan-(1E)-ylidenemethyl]-pyridine DMG76LS Discovery agent N.A. Investigative [35]
3-[6-Methyl-indan-(1Z)-ylidenemethyl]-pyridine DMKOB2T Discovery agent N.A. Investigative [35]
3-[7-Methoxy-indan-(1E)-ylidenemethyl]-pyridine DMVWIQ2 Discovery agent N.A. Investigative [35]
4'-(Pyridin-4-ylmethyl)biphenyl-3,4-diol DM6Z5EK Discovery agent N.A. Investigative [40]
4'-(Pyridin-4-ylmethyl)biphenyl-3-amine DMR8O1B Discovery agent N.A. Investigative [40]
4'-bromo-3-(imidazolylmethyl)-7-methoxyflavone DMK2PBJ Discovery agent N.A. Investigative [39]
4'-bromo-3-(imidazolylmethyl)flavone DM2V3S8 Discovery agent N.A. Investigative [39]
4'-cyano-3-(imidazolylmethyl)-7-methoxyflavone DMWGF9R Discovery agent N.A. Investigative [39]
4'-cyano-3-(imidazolylmethyl)flavone DMUJS4R Discovery agent N.A. Investigative [39]
4-((1H-imidazol-1-yl)methyl)-2H-chromen-2-one DMDHV0N Discovery agent N.A. Investigative [24]
4-((1H-imidazol-1-yl)methyl)benzonitrile DMFUBRC Discovery agent N.A. Investigative [28]
4-(1-Imidazol-1-yl-vinyl)-benzonitrile DM08963 Discovery agent N.A. Investigative [41]
4-(2,2-Diphenyl-vinyl)-pyridine DMI638K Discovery agent N.A. Investigative [35]
4-(2-(1H-imidazol-1-yl)ethoxy)-2H-chromen-2-one DM1043B Discovery agent N.A. Investigative [24]
4-(3,4,5-Trimethoxyphenethyl)aniline DMNUWK2 Discovery agent N.A. Investigative [27]
4-(3,4-Dimethoxyphenethyl)aniline DMBI7MS Discovery agent N.A. Investigative [27]
4-(3,5-Dimethoxyphenethyl)benzenamine DM4FC9O Discovery agent N.A. Investigative [27]
4-ANDROSTENE-3-17-DIONE DMSE8NU Discovery agent N.A. Investigative [42], [43]
4-Bromo-1-imidazol-1-ylmethyl-xanthen-9-one DMMVASI Discovery agent N.A. Investigative [30]
4-Fluoren-9-ylidenemethyl-pyridine DMW9I1X Discovery agent N.A. Investigative [35]
4-Imidazol-1-yl-2-phenyl-chroman-7-ol DMJKF17 Discovery agent N.A. Investigative [29]
4-Imidazol-1-ylmethyl-1-nitro-xanthen-9-one DMZLVIF Discovery agent N.A. Investigative [30]
4-Imidazol-1-ylmethyl-1-nitrothioxanthen-9-one DM28DEU Discovery agent N.A. Investigative [25]
4-Imidazol-1-ylmethyl-2-nitroxanthen-9-one DM6FMO1 Discovery agent N.A. Investigative [25]
4-Imidazol-1-ylmethyl-3-nitroxanthen-9-one DM8KZQN Discovery agent N.A. Investigative [25]
4-Imidazol-1-ylmethylthioxanthen-9-one DMVUSMP Discovery agent N.A. Investigative [25]
4-Imidazol-1-ylmethylxanthen-9-one DMM8HK0 Discovery agent N.A. Investigative [25]
4-Indan-(1E)-ylidenemethyl-pyridine DMFRCQS Discovery agent N.A. Investigative [35]
4-Indan-(1Z)-ylidenemethyl-pyridine DM25DR7 Discovery agent N.A. Investigative [35]
4-[(3'-Hydroxybiphenyl-4-yl)methyl]pyridine DM04MK7 Discovery agent N.A. Investigative [40]
4-[(4'-Hydroxybiphenyl-4-yl)methyl]pyridine DMIEMWA Discovery agent N.A. Investigative [40]
4-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine DMQKHXN Discovery agent N.A. Investigative [35]
4-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine DMZL8KN Discovery agent N.A. Investigative [35]
4-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine DM1Z3DG Discovery agent N.A. Investigative [35]
4-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine DMY08FE Discovery agent N.A. Investigative [35]
4-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine DMHDZUO Discovery agent N.A. Investigative [35]
4-[5-Methoxy-indan-(1E)-ylidenemethyl]-pyridine DM25GS6 Discovery agent N.A. Investigative [35]
4-[5-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine DMLBX4Q Discovery agent N.A. Investigative [35]
4-[6-Methoxy-indan-(1E)-ylidenemethyl]-pyridine DM3IR8Y Discovery agent N.A. Investigative [35]
4-[6-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine DMIBZJC Discovery agent N.A. Investigative [35]
4-[6-Methyl-indan-(1E)-ylidenemethyl]-pyridine DMYGN1K Discovery agent N.A. Investigative [35]
4-[6-Methyl-indan-(1Z)-ylidenemethyl]-pyridine DM5VN3D Discovery agent N.A. Investigative [35]
5-((1H-imidazol-1-yl)methyl)-7,8-dihydroquinoline DML4DSG Discovery agent N.A. Investigative [24]
5-(2-(1H-imidazol-1-yl)ethyl)quinoline DMA2GIE Discovery agent N.A. Investigative [24]
5-Bromo-8-imidazol-1-ylmethyl-chromen-4-one DM09Y72 Discovery agent N.A. Investigative [30]
5-Indan-(1E)-ylidenemethyl-1H-imidazole DMW8AOM Discovery agent N.A. Investigative [44]
5-Indan-(1Z)-ylidenemethyl-1H-imidazole DMKLY20 Discovery agent N.A. Investigative [44]
5-Pyridin-3-yl-1,3-dihydro-2H-indol-2-one DMLRM9Z Discovery agent N.A. Investigative [38]
5-Pyridin-3-yl-2,3-dihydro-1H-inden-1-one DMQYIBC Discovery agent N.A. Investigative [38]
5-[5-Bromo-indan-(1E)-ylidenemethyl]-1H-imidazole DMV7QU3 Discovery agent N.A. Investigative [44]
5-[5-Bromo-indan-(1Z)-ylidenemethyl]-1H-imidazole DMZICL8 Discovery agent N.A. Investigative [44]
5-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyrimidine DM2RIHT Discovery agent N.A. Investigative [35]
5-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyrimidine DMQGX2Z Discovery agent N.A. Investigative [35]
5-[5-Methoxy-indan-(1E)-ylidenemethyl]-thiazole DM5FA74 Discovery agent N.A. Investigative [35]
5-[5-Methoxy-indan-(1Z)-ylidenemethyl]-thiazole DMPDN63 Discovery agent N.A. Investigative [35]
6-((1H-imidazol-1-yl)methyl)-2H-chromene-2-thione DMOR04W Discovery agent N.A. Investigative [24]
6-Imidazol-1-yl-isoquinoline DMQXL1Y Discovery agent N.A. Investigative [24]
7,4'-Dihydroxyflavone DMXQ1K0 Discovery agent N.A. Investigative [8]
7-((1H-imidazol-1-yl)methyl)-2H-chromen-2-one DM2UTEA Discovery agent N.A. Investigative [24]
7-((1H-imidazol-1-yl)methyl)-4H-chromen-4-one DMOS4ZQ Discovery agent N.A. Investigative [24]
7-((1H-imidazol-1-yl)methyl)isoquinoline DM9ID4T Discovery agent N.A. Investigative [24]
7-(2-(1H-imidazol-1-yl)ethoxy)-2H-chromen-2-one DM4HUO1 Discovery agent N.A. Investigative [45]
7-hydroxy-2-(3-hydroxyphenyl)chroman-4-one DMXBUNV Discovery agent N.A. Investigative [21]
7-hydroxy-2-phenylchroman-4-one DM4UW65 Discovery agent N.A. Investigative [21]
7-[1,2,4]Triazol-4-ylmethyl-chromen-4-one DMNGLM1 Discovery agent N.A. Investigative [30]
8-Imidazol-1-ylmethyl-5-nitro-chromen-4-one DMA26L4 Discovery agent N.A. Investigative [30]
9-Hydroxy-7,8-benzoflavone DMH72MU Discovery agent N.A. Investigative [8]
ALBANOL A DMHIW2L Discovery agent N.A. Investigative [22]
Alpha-naphthoflavone DMELOIQ Discovery agent N.A. Investigative [8]
ANDROSTENEDONE DMPL0BA Discovery agent N.A. Investigative [46]
Apigenin DMI3491 Discovery agent N.A. Investigative [8]
Benzyl-biphenyl-4-ylmethyl-imidazol-1-yl-amine DMFB4M5 Discovery agent N.A. Investigative [23]
biochanin A DM0HPWY Discovery agent N.A. Investigative [8]
Broussoflavonol F DMB9SEI Discovery agent N.A. Investigative [22]
CGS-18320B DM2CS5A Discovery agent N.A. Investigative [8]
Chrysin DM7V2LG Discovery agent N.A. Investigative [8]
DEHYDROLEUCODIN DM0V1NH Discovery agent N.A. Investigative [8]
Docosapentaenoic acid DMVCP6X Discovery agent N.A. Investigative [47]
Flavone DMEQH6J Discovery agent N.A. Investigative [8]
Gamma-mangostin DMC0OVP Discovery agent N.A. Investigative [48]
GARCINONE D DMQDV3U Discovery agent N.A. Investigative [48]
GOSSYPETIN DMMT05U Discovery agent N.A. Investigative [49]
Isogemichalcone C DM31AXO Discovery agent N.A. Investigative [22]
ISOLICOFLAVONOL DMYEGBC Discovery agent N.A. Investigative [22]
LIQUIRTIGENIN DM6YSG3 Discovery agent N.A. Investigative [49]
LUDARTIN DMI9VNO Discovery agent N.A. Investigative [8]
MDL-18962 DMTVOWC Discovery agent N.A. Investigative [50]
MONODICTYOCHROMONE B DM59CR0 Discovery agent N.A. Investigative [51]
MORACHALCONE A DMWR0J1 Discovery agent N.A. Investigative [22]
MR-16089 DMM2WG7 Discovery agent N.A. Investigative [8]
MR-20492 DMEBQLK Discovery agent N.A. Investigative [8]
MR-20494 DMC79YF Discovery agent N.A. Investigative [8]
MR-20496 DMTCG8M Discovery agent N.A. Investigative [52]
MR-20814 DMSR3OI Discovery agent N.A. Investigative [52]
N-(2-benzyloxy-4-nitrophenyl)methanesulfonamide DMW5XLG Discovery agent N.A. Investigative [53]
N-(2-hexyloxy-4-nitrophenyl)methanesulfonamide DM27L53 Discovery agent N.A. Investigative [54]
N-(2-nonyloxy-4-nitrophenyl)methanesulfonamide DMU6FPL Discovery agent N.A. Investigative [54]
N-(2-Propyloxy-4-nitrophenyl)methanesulfonamide DMAQMXJ Discovery agent N.A. Investigative [54]
N-[2-(4'-Nitrophenyl)ethyl]-imidazole DMPKBT1 Discovery agent N.A. Investigative [8]
NSC-122427 DMYMB4A Discovery agent N.A. Investigative [55]
NSC-12999 DMJAO6Z Discovery agent N.A. Investigative [24]
NSC-131736 DMYJNS9 Discovery agent N.A. Investigative [24]
NSC-289311 DMZU1L0 Discovery agent N.A. Investigative [24]
NSC-356483 DMEK5B2 Discovery agent N.A. Investigative [24]
NSC-356781 DM9LI7M Discovery agent N.A. Investigative [24]
NSC-368272 DMR97X3 Discovery agent N.A. Investigative [24]
NSC-368280 DMR3IP5 Discovery agent N.A. Investigative [24]
NSC-369087 DMAQWM8 Discovery agent N.A. Investigative [24]
NSC-613604 DMD1XM0 Discovery agent N.A. Investigative [55]
NSC-625409 DM0GWAC Discovery agent N.A. Investigative [24]
NSC-666292 DMNMF0C Discovery agent N.A. Investigative [24]
NSC-683634 DMZ2KUB Discovery agent N.A. Investigative [24]
NSC-75308 DM8GZAM Discovery agent N.A. Investigative [24]
NSC-93358 DMTOFS7 Discovery agent N.A. Investigative [55]
NSC-94258 DM6VY3P Discovery agent N.A. Investigative [8]
NSC-94891 DM31CZK Discovery agent N.A. Investigative [55]
Org-33201 DMDY38R Discovery agent N.A. Investigative [56]
------------------------------------------------------------------------------------
⏷ Show the Full List of 220 Investigative Drug(s)

The Drug-Metabolizing Enzyme (DME) Role of This DTT

DTT DME Name Aromatase (CYP19A1) DME Info
Gene Name CYP19A1
7 Approved Drug(s) Metabolized by This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Letrozole DMH07Y3 Hormonally-responsive breast cancer 2C60-2C65 Approved [57]
Levomethadyl acetate hydrochloride DM429AE Opioid dependence 6C43.2Z Approved [58]
Methadone DMTW6IU Dry cough MD12 Approved [59]
Nandrolone DMFWKG1 Osteoporosis FB83.0 Approved [60]
Prasterone DM67VKL Chronic obstructive pulmonary disease CA22 Approved [61]
Testosterone cypionate DMC1TEV Testosterone deficiency 5A81.1 Approved [62]
Dihydrotestosterone DM3S8XC Prostate hyperplasia GA90 Phase 4 [63]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Approved Drug(s)

References

1 Aminoglutethimide-induced protein free radical formation on myeloperoxidase: a potential mechanism of agranulocytosis. Chem Res Toxicol. 2007 Jul;20(7):1038-45.
2 Effective aromatase inhibition by anastrozole in a patient with gonadotropin-independent precocious puberty in McCune-Albright syndrome. J Pediatr Endocrinol Metab. 2002;15 Suppl 3:945-8.
3 Aromatase inhibitors for male infertility. J Urol. 2002 Feb;167(2 Pt 1):624-9.
4 Aromatase inhibitors--theoretical concept and present experiences in the treatment of endometriosis. Zentralbl Gynakol. 2003 Jul-Aug;125(7-8):247-51.
5 Enantioselective nonsteroidal aromatase inhibitors identified through a multidisciplinary medicinal chemistry approach. J Med Chem. 2005 Nov 17;48(23):7282-9.
6 Testosterone versus testosterone and testolactone in treating reproductive and sexual dysfunction in men with epilepsy and hypogonadism. Neurology. 1998 Mar;50(3):782-4.
7 Toremifene-atamestane; alone or in combination: predictions from the preclinical intratumoral aromatase model. J Steroid Biochem Mol Biol. 2008 Jan;108(1-2):1-7.
8 Pharmacophore modeling strategies for the development of novel nonsteroidal inhibitors of human aromatase (CYP19). Bioorg Med Chem Lett. 2010 May 15;20(10):3050-64.
9 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032111)
10 Highly potent first examples of dual aromatase-steroid sulfatase inhibitors based on a biphenyl template. J Med Chem. 2010 Mar 11;53(5):2155-70.
11 Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
12 The taiwaniaquinoids: a review. J Nat Prod. 2010 Feb 26;73(2):284-98.
13 Pharmacokinetics of finrozole (MPV-2213ad), a novel selective aromatase inhibitor, in healthy men. Br J Clin Pharmacol. 2001 Dec;52(6):702-4.
14 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
15 Effects of aromatase inhibitors on the pathobiology of the human breast, endometrial and ovarian carcinoma. Endocr Relat Cancer. 1999 Jun;6(2):197-204.
16 Chiral aromatase and dual aromatase-steroid sulfatase inhibitors from the letrozole template: synthesis, absolute configuration, and in vitro activ... J Med Chem. 2008 Jul 24;51(14):4226-38.
17 First dual aromatase-steroid sulfatase inhibitors. J Med Chem. 2003 Jul 17;46(15):3193-6.
18 High-performance liquid chromatographic determination of FCE 24928, a new aromatase inhibitor, in human plasma. J Chromatogr A. 1994 Feb 4;660(1-2):293-8.
19 Analogues of 3-ethyl-3-(4-pyridyl)piperidine-2,6-dione as selective inhibitors of aromatase: derivatives with variable 1-alkyl and 3-alkyl substitu... J Med Chem. 1987 Sep;30(9):1550-4.
20 Synthesis and biological evaluation of (+/-)-abyssinone II and its analogues as aromatase inhibitors for chemoprevention of breast cancer. J Med Chem. 2007 Jun 14;50(12):2799-806.
21 New 7,8-benzoflavanones as potent aromatase inhibitors: synthesis and biological evaluation. Bioorg Med Chem. 2008 Feb 1;16(3):1474-80.
22 Aromatase inhibitors from Broussonetia papyrifera. J Nat Prod. 2001 Oct;64(10):1286-93.
23 CYP19 (aromatase): exploring the scaffold flexibility for novel selective inhibitors. Bioorg Med Chem. 2008 Sep 15;16(18):8349-58.
24 Fast three dimensional pharmacophore virtual screening of new potent non-steroid aromatase inhibitors. J Med Chem. 2009 Jan 8;52(1):143-50.
25 Novel highly potent and selective nonsteroidal aromatase inhibitors: synthesis, biological evaluation and structure-activity relationships investigation. J Med Chem. 2010 Jul 22;53(14):5347-51.
26 Heteroaryl-substituted naphthalenes and structurally modified derivatives: selective inhibitors of CYP11B2 for the treatment of congestive heart fa... J Med Chem. 2005 Oct 20;48(21):6632-42.
27 Design, synthesis, and biological evaluation of resveratrol analogues as aromatase and quinone reductase 2 inhibitors for chemoprevention of cancer. Bioorg Med Chem. 2010 Jul 15;18(14):5352-66.
28 Fadrozole hydrochloride: a potent, selective, nonsteroidal inhibitor of aromatase for the treatment of estrogen-dependent disease. J Med Chem. 1991 Feb;34(2):725-36.
29 Synthesis and evaluation of 4-triazolylflavans as new aromatase inhibitors. Bioorg Med Chem Lett. 2004 Oct 18;14(20):5215-8.
30 A new class of nonsteroidal aromatase inhibitors: design and synthesis of chromone and xanthone derivatives and inhibition of the P450 enzymes aromatase and 17 alpha-hydroxylase/C17,20-lyase. J Med Chem. 2001 Mar 1;44(5):672-80.
31 New selective nonsteroidal aromatase inhibitors: synthesis and inhibitory activity of 2,3 or 5-(alpha-azolylbenzyl)-1H-indoles. Bioorg Med Chem Lett. 1999 Feb 8;9(3):333-6.
32 Synthesis and characterization of azole isoflavone inhibitors of aromatase. Bioorg Med Chem. 2005 Jun 2;13(12):4063-70.
33 New aromatase inhibitors. Synthesis and inhibitory activity of pyridinyl-substituted flavanone derivatives. Bioorg Med Chem Lett. 2002 Apr 8;12(7):1059-61.
34 Synthesis and evaluation of heteroaryl-substituted dihydronaphthalenes and indenes: potent and selective inhibitors of aldosterone synthase (CYP11B... J Med Chem. 2006 Apr 6;49(7):2222-31.
35 Synthesis and evaluation of (pyridylmethylene)tetrahydronaphthalenes/-indanes and structurally modified derivatives: potent and selective inhibitor... J Med Chem. 2005 Mar 10;48(5):1563-75.
36 Synthesis and biochemical evaluation of analogues of aminoglutethimide based on phenylpyrrolidine-2,5-dione. J Med Chem. 1986 Apr;29(4):520-3.
37 Aromatase inhibitors. Synthesis and evaluation of mammary tumor inhibiting activity of 3-alkylated 3-(4-aminophenyl)piperidine-2,6-diones. J Med Chem. 1986 Aug;29(8):1362-9.
38 In vivo active aldosterone synthase inhibitors with improved selectivity: lead optimization providing a series of pyridine substituted 3,4-dihydro-... J Med Chem. 2008 Dec 25;51(24):8077-87.
39 Lead optimization providing a series of flavone derivatives as potent nonsteroidal inhibitors of the cytochrome P450 aromatase enzyme. J Med Chem. 2006 Jul 27;49(15):4777-80.
40 Replacement of imidazolyl by pyridyl in biphenylmethylenes results in selective CYP17 and dual CYP17/CYP11B1 inhibitors for the treatment of prosta... J Med Chem. 2010 Aug 12;53(15):5749-58.
41 Aromatase inhibitors: synthesis, biological activity, and binding mode of azole-type compounds. J Med Chem. 1993 May 14;36(10):1393-400.
42 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
43 Synthesis of androst-5-en-7-ones and androsta-3,5-dien-7-ones and their related 7-deoxy analogs as conformational and catalytic probes for the acti... J Med Chem. 1994 Jul 8;37(14):2198-205.
44 Synthesis and evaluation of imidazolylmethylenetetrahydronaphthalenes and imidazolylmethyleneindanes: potent inhibitors of aldosterone synthase. J Med Chem. 2005 Mar 24;48(6):1796-805.
45 Design, synthesis, and 3D QSAR of novel potent and selective aromatase inhibitors. J Med Chem. 2004 Dec 30;47(27):6792-803.
46 Effects of steroid D-ring modification on suicide inactivation and competitive inhibition of aromatase by analogues of androsta-1,4-diene-3,17-dione. J Med Chem. 1989 Mar;32(3):651-8.
47 Interference by naturally occurring fatty acids in a noncellular enzyme-based aromatase bioassay. J Nat Prod. 2006 Apr;69(4):700-3.
48 Xanthones from the botanical dietary supplement mangosteen (Garcinia mangostana) with aromatase inhibitory activity. J Nat Prod. 2008 Jul;71(7):1161-6.
49 Screening of herbal constituents for aromatase inhibitory activity. Bioorg Med Chem. 2008 Sep 15;16(18):8466-70.
50 6 beta-Propynyl-substituted steroids: mechanism-based enzyme-activated irreversible inhibitors of aromatase. J Med Chem. 1997 Sep 26;40(20):3263-70.
51 Monodictyochromes A and B, dimeric xanthone derivatives from the marine algicolous fungus Monodictys putredinis. J Nat Prod. 2008 Nov;71(11):1793-9.
52 Design and synthesis of a new type of non steroidal human aromatase inhibitors. Bioorg Med Chem Lett. 1998 May 5;8(9):1041-4.
53 Synthesis and biological evaluation of selective aromatase expression regulators in breast cancer cells. J Med Chem. 2007 Apr 5;50(7):1635-44.
54 Novel sulfonanilide analogues suppress aromatase expression and activity in breast cancer cells independent of COX-2 inhibition. J Med Chem. 2006 Feb 23;49(4):1413-9.
55 An efficient steroid pharmacophore-based strategy to identify new aromatase inhibitors. Eur J Med Chem. 2009 Oct;44(10):4121-7.
56 Org 33201: a new highly selective orally active aromatase inhibitor. J Steroid Biochem Mol Biol. 1993 Mar;44(4-6):681-2.
57 Double-blind, randomised, multicentre endocrine trial comparing two letrozole doses, in postmenopausal breast cancer patients. Eur J Cancer. 1999 Feb;35(2):208-13.
58 N-demethylation of levo-alpha-acetylmethadol by human placental aromatase. Biochem Pharmacol. 2004 Mar 1;67(5):885-92.
59 Bidirectional transfer of methadone across human placenta. Biochem Pharmacol. 2005 Jan 1;69(1):187-97.
60 Aromatization of testosterone and 19-nortestosterone by a single enzyme from equine testicular microsomes. Differences from human placental aromatase. J Steroid Biochem. 1988 Jan;29(1):119-25.
61 Urinary and serum octopamine in patients with portal-systemic encephalopathy. Lancet. 1975 Nov 15;2(7942):943-6.
62 Loss of aromatase cytochrome P450 function as a risk factor for Parkinson's disease? Brain Res Rev. 2008 Mar;57(2):431-43.
63 Identifying susceptibility genes for prostate cancer--a family-based association study of polymorphisms in CYP17, CYP19, CYP11A1, and LH-beta. Cancer Epidemiol Biomarkers Prev. 2005 Aug;14(8):2035-9.