Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3MSU3B)

DOT Name Tissue factor (F3)
Synonyms TF; Coagulation factor III; Thromboplastin; CD antigen CD142
Gene Name F3
UniProt ID
TF_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1AHW ; 1BOY ; 1DAN ; 1FAK ; 1J9C ; 1JPS ; 1O5D ; 1TFH ; 1UJ3 ; 1W0Y ; 1W2K ; 1WQV ; 1WSS ; 1WTG ; 1WUN ; 1WV7 ; 1Z6J ; 2A2Q ; 2AEI ; 2AER ; 2B7D ; 2B8O ; 2C4F ; 2CEF ; 2CEH ; 2CEZ ; 2CFJ ; 2EC9 ; 2F9B ; 2FIR ; 2FLB ; 2FLR ; 2HFT ; 2PUQ ; 2ZP0 ; 2ZWL ; 2ZZU ; 3ELA ; 3TH2 ; 3TH3 ; 3TH4 ; 4IBL ; 4M7L ; 4YLQ ; 4Z6A ; 4ZMA ; 5W06 ; 6R2W ; 6Z9W
Pfam ID
PF09294 ; PF01108
Sequence
METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
PVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGS
AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG
KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE
CMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS
Function
Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited proteolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.
Tissue Specificity Lung, placenta and pancreas.
KEGG Pathway
Complement and coagulation cascades (hsa04610 )
AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 )
Reactome Pathway
NGF-stimulated transcription (R-HSA-9031628 )
Extrinsic Pathway of Fibrin Clot Formation (R-HSA-140834 )
BioCyc Pathway
MetaCyc:ENSG00000117525-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
75 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Tissue factor (F3). [1]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Tissue factor (F3). [2]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Tissue factor (F3). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Tissue factor (F3). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Tissue factor (F3). [5]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Tissue factor (F3). [6]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Tissue factor (F3). [8]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Tissue factor (F3). [9]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Tissue factor (F3). [2]
Triclosan DMZUR4N Approved Triclosan increases the expression of Tissue factor (F3). [10]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Tissue factor (F3). [11]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Tissue factor (F3). [12]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Tissue factor (F3). [13]
Progesterone DMUY35B Approved Progesterone increases the expression of Tissue factor (F3). [14]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Tissue factor (F3). [15]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Tissue factor (F3). [16]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Tissue factor (F3). [17]
Bortezomib DMNO38U Approved Bortezomib increases the expression of Tissue factor (F3). [16]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of Tissue factor (F3). [18]
Ethanol DMDRQZU Approved Ethanol increases the expression of Tissue factor (F3). [19]
Etoposide DMNH3PG Approved Etoposide increases the expression of Tissue factor (F3). [11]
Malathion DMXZ84M Approved Malathion increases the expression of Tissue factor (F3). [20]
Simvastatin DM30SGU Approved Simvastatin decreases the expression of Tissue factor (F3). [21]
Cyclophosphamide DM4O2Z7 Approved Cyclophosphamide decreases the expression of Tissue factor (F3). [22]
Ibuprofen DM8VCBE Approved Ibuprofen increases the expression of Tissue factor (F3). [23]
Daunorubicin DMQUSBT Approved Daunorubicin increases the expression of Tissue factor (F3). [24]
Palbociclib DMD7L94 Approved Palbociclib increases the expression of Tissue factor (F3). [25]
Imatinib DM7RJXL Approved Imatinib increases the expression of Tissue factor (F3). [19]
Dactinomycin DM2YGNW Approved Dactinomycin decreases the expression of Tissue factor (F3). [26]
Glutathione DMAHMT9 Approved Glutathione increases the activity of Tissue factor (F3). [27]
Crizotinib DM4F29C Approved Crizotinib increases the expression of Tissue factor (F3). [19]
Fructose DM43AN2 Approved Fructose increases the expression of Tissue factor (F3). [28]
Ergotidine DM78IME Approved Ergotidine increases the expression of Tissue factor (F3). [29]
Nicotinamide DMUPE07 Approved Nicotinamide decreases the expression of Tissue factor (F3). [30]
Norepinephrine DMOUC09 Approved Norepinephrine increases the expression of Tissue factor (F3). [31]
Amphetamine DMSZQAK Approved Amphetamine increases the activity of Tissue factor (F3). [32]
Tibolone DM78XFG Approved Tibolone increases the expression of Tissue factor (F3). [33]
Dobutamine DMD1B8Z Approved Dobutamine increases the expression of Tissue factor (F3). [34]
Plicamycin DM7C8YV Approved Plicamycin decreases the expression of Tissue factor (F3). [35]
Primaquine DMWQ16I Approved Primaquine increases the expression of Tissue factor (F3). [19]
Desloratadine DM56YN7 Approved Desloratadine increases the expression of Tissue factor (F3). [19]
Enalapril DMNFUZR Approved Enalapril decreases the expression of Tissue factor (F3). [36]
Primidone DM0WX6I Approved Primidone increases the expression of Tissue factor (F3). [19]
ABIRATERONE DM8V75C Approved ABIRATERONE increases the expression of Tissue factor (F3). [19]
Terconazole DMJ13KI Approved Terconazole increases the expression of Tissue factor (F3). [19]
Histamine Phosphate DMV7IM6 Approved Histamine Phosphate increases the expression of Tissue factor (F3). [19]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Tissue factor (F3). [37]
Tamibarotene DM3G74J Phase 3 Tamibarotene decreases the expression of Tissue factor (F3). [38]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Tissue factor (F3). [39]
PEITC DMOMN31 Phase 2 PEITC decreases the expression of Tissue factor (F3). [40]
MK-2206 DMT1OZ6 Phase 2 MK-2206 increases the expression of Tissue factor (F3). [19]
Bryostatin-1 DM1JOXY Phase 2 Bryostatin-1 increases the expression of Tissue factor (F3). [19]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Tissue factor (F3). [41]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Tissue factor (F3). [42]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Tissue factor (F3). [43]
SB 203580 DMAET6F Terminated SB 203580 decreases the expression of Tissue factor (F3). [44]
GGTI-298 DM1CG0J Terminated GGTI-298 decreases the expression of Tissue factor (F3). [45]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Tissue factor (F3). [46]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Tissue factor (F3). [47]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of Tissue factor (F3). [48]
D-glucose DMMG2TO Investigative D-glucose increases the expression of Tissue factor (F3). [49]
QUERCITRIN DM1DH96 Investigative QUERCITRIN increases the expression of Tissue factor (F3). [50]
Lithium chloride DMHYLQ2 Investigative Lithium chloride decreases the expression of Tissue factor (F3). [44]
OXYQUINOLINE DMZVS9Y Investigative OXYQUINOLINE increases the expression of Tissue factor (F3). [19]
Arachidonic acid DMUOQZD Investigative Arachidonic acid increases the expression of Tissue factor (F3). [17]
U0126 DM31OGF Investigative U0126 decreases the expression of Tissue factor (F3). [44]
1,4-Dithiothreitol DMIFOXE Investigative 1,4-Dithiothreitol increases the activity of Tissue factor (F3). [27]
Anandamide DMCKH3P Investigative Anandamide increases the expression of Tissue factor (F3). [17]
Erythropoietin DM3R8YL Investigative Erythropoietin decreases the expression of Tissue factor (F3). [36]
Methylenedioxymethamphetamine DMYVU47 Investigative Methylenedioxymethamphetamine increases the activity of Tissue factor (F3). [32]
Heme DMGC287 Investigative Heme increases the expression of Tissue factor (F3). [51]
2-chloro-5-nitro-N-phenylbenzamide DMUGQIV Investigative 2-chloro-5-nitro-N-phenylbenzamide increases the expression of Tissue factor (F3). [19]
torin 1 DMZD0NA Investigative torin 1 increases the expression of Tissue factor (F3). [19]
Torin2 DMC6U93 Investigative Torin2 increases the expression of Tissue factor (F3). [19]
AR-00341677 DMK2XB7 Investigative AR-00341677 increases the expression of Tissue factor (F3). [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 75 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Tissue factor (F3). [7]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Tissue factors on acute promyelocytic leukemia and endothelial cells are differently regulated by retinoic acid, arsenic trioxide and chemotherapeutic agents. Leukemia. 1999 Jul;13(7):1062-70. doi: 10.1038/sj.leu.2401448.
3 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
7 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
8 Resveratrol and quercetin down-regulate tissue factor expression by human stimulated vascular cells. J Thromb Haemost. 2003 May;1(5):1089-95. doi: 10.1046/j.1538-7836.2003.00217.x.
9 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
10 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
11 The effects of chemotherapeutic agents on the regulation of thrombin on cell surfaces. Br J Haematol. 2003 Jan;120(2):315-24. doi: 10.1046/j.1365-2141.2003.03971.x.
12 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
13 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
14 Progesterone increases tissue factor gene expression, procoagulant activity, and invasion in the breast cancer cell line ZR-75-1. J Clin Endocrinol Metab. 2005 Feb;90(2):1181-8. doi: 10.1210/jc.2004-0857. Epub 2004 Nov 23.
15 Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
16 Activation of coagulation by lenalidomide-based regimens for the treatment of multiple myeloma. PLoS One. 2013 May 16;8(5):e64369. doi: 10.1371/journal.pone.0064369. Print 2013.
17 Inhibition of interleukin-1-induced endothelial tissue factor expression by the synthetic cannabinoid WIN 55,212-2. Oncotarget. 2016 Sep 20;7(38):61438-61457. doi: 10.18632/oncotarget.11367.
18 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
19 Elucidating mechanisms of toxicity using phenotypic data from primary human cell systems--a chemical biology approach for thrombosis-related side effects. Int J Mol Sci. 2015 Jan 5;16(1):1008-29. doi: 10.3390/ijms16011008.
20 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
21 Simvastatin attenuates vascular hypercoagulability in cardiac transplant recipients. Transplantation. 2000 May 15;69(9):1830-6. doi: 10.1097/00007890-200005150-00017.
22 Comparative gene expression analysis of a chronic myelogenous leukemia cell line resistant to cyclophosphamide using oligonucleotide arrays and response to tyrosine kinase inhibitors. Leuk Res. 2007 Nov;31(11):1511-20.
23 Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
24 [Effects of all-trans retinoic acid, arsenic trioxide and daunorubicin on tissue factor expression in NB4 cells]. Zhonghua Xue Ye Xue Za Zhi. 1999 Sep;20(9):453-5.
25 Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
26 Mechanisms of tissue factor induction by the uremic toxin indole-3 acetic acid through aryl hydrocarbon receptor/nuclear factor-kappa B signaling pathway in human endothelial cells. Arch Toxicol. 2019 Jan;93(1):121-136.
27 Tissue factor activation: is disulfide bond switching a regulatory mechanism?. Blood. 2007 Dec 1;110(12):3900-8. doi: 10.1182/blood-2007-07-101469. Epub 2007 Aug 28.
28 Non-nutritional sweeteners effects on endothelial vascular function. Toxicol In Vitro. 2020 Feb;62:104694. doi: 10.1016/j.tiv.2019.104694. Epub 2019 Oct 23.
29 Histamine induces tissue factor expression: implications for acute coronary syndromes. Circulation. 2005 Jul 19;112(3):341-9. doi: 10.1161/CIRCULATIONAHA.105.553735. Epub 2005 Jul 11.
30 Nicotinamide inhibits tissue factor expression in isolated human pancreatic islets: implications for clinical islet transplantation. Transplantation. 2003 Nov 15;76(9):1285-8. doi: 10.1097/01.TP.0000098905.86445.0F.
31 Targeting activation of specific NF-B subunits prevents stress-dependent atherothrombotic gene expression. Mol Med. 2012 Dec 20;18(1):1375-86. doi: 10.2119/molmed.2012.00282.
32 Amphetamines induce tissue factor and impair tissue factor pathway inhibitor: role of dopamine receptor type 4. Eur Heart J. 2010 Jul;31(14):1780-91. doi: 10.1093/eurheartj/ehp598. Epub 2010 Jan 29.
33 Tibolone and its metabolites enhance tissue factor and PAI-1 expression in human endometrial stromal cells: Evidence of progestogenic effects. Steroids. 2005 Nov;70(12):840-5. doi: 10.1016/j.steroids.2005.04.010.
34 Myocardial ischemia induces interleukin-6 and tissue factor production in patients with coronary artery disease: a dobutamine stress echocardiography study. Circulation. 2005 Nov 22;112(21):3272-9. doi: 10.1161/CIRCULATIONAHA.104.532259. Epub 2005 Nov 14.
35 Asbestos induces tissue factor in Beas-2B human lung bronchial epithelial cells in vitro. Lung. 2004;182(4):251-64. doi: 10.1007/s00408-004-2507-2.
36 Inhibition of the renin-angiotensin system downregulates tissue factor and vascular endothelial growth factor in human breast carcinoma cells. Thromb Res. 2012 Jun;129(6):736-42. doi: 10.1016/j.thromres.2011.11.047. Epub 2011 Dec 19.
37 Mechanism of resveratrol-mediated suppression of tissue factor gene expression. Thromb Haemost. 2002 Jan;87(1):155-62.
38 Promyelocytic leukemia retinoid signaling targets regulate apoptosis,tissue factor and thrombomodulin expression. Haematologica. 2004 Mar;89(3):286-95.
39 Resveratrol, a polyphenolic compound found in wine, inhibits tissue factor expression in vascular cells : A possible mechanism for the cardiovascular benefits associated with moderate consumption of wine. Arterioscler Thromb Vasc Biol. 1999 Feb;19(2):419-26. doi: 10.1161/01.atv.19.2.419.
40 Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
41 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
42 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
43 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
44 Asbestos induces tissue factor in Beas-2B cells via PI3 kinase-PKC-mediated signaling. J Toxicol Environ Health A. 2004 Oct 8;67(19):1537-47. doi: 10.1080/15287390490486716.
45 Simvastatin has an anti-inflammatory effect on macrophages via upregulation of an atheroprotective transcription factor, Kruppel-like factor 2. Cardiovasc Res. 2008 Apr 1;78(1):175-84.
46 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
47 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
48 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
49 Fluorometholone inhibits high glucose-induced cellular senescence in human retinal endothelial cells. Hum Exp Toxicol. 2022 Jan-Dec;41:9603271221076107. doi: 10.1177/09603271221076107.
50 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
51 Heme induces endothelial tissue factor expression: potential role in hemostatic activation in patients with hemolytic anemia. J Thromb Haemost. 2008 Dec;6(12):2202-9. doi: 10.1111/j.1538-7836.2008.03177.x. Epub 2008 Oct 1.