Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUQ9E0D)

• DOT Name: Max-interacting protein 1 (MXI1)
• Synonyms: Max interactor 1; Class C basic helix-loop-helix protein 11; bHLHc11
• Gene Name: MXI1
• Related Disease:
  Neuroblastoma
  Adenocarcinoma
  B-cell lymphoma
  Bladder cancer
  Bone osteosarcoma
  Breast adenocarcinoma
  Breast cancer
  Cardiovascular disease
  Clear cell renal carcinoma
  Colon carcinoma
  Epithelial ovarian cancer
  Glioma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Lung neoplasm
  Myelodysplastic syndrome
  Nasopharyngeal carcinoma
  Nephropathy
  Osteosarcoma
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Retinoblastoma
  Small lymphocytic lymphoma
  Small-cell lung cancer
  Thrombocytopenia
  Ulcerative colitis
  Urinary bladder cancer
  Urinary bladder neoplasm
  Adult glioblastoma
  Breast carcinoma
  Carcinoma
  Gastric cancer
  Glioblastoma multiforme
  Lung cancer
  Lung carcinoma
  Polycystic kidney disease
  Squamous cell carcinoma
  Stomach cancer
  Medulloblastoma
  Colorectal carcinoma
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
• UniProt ID: MXI1_HUMAN
• Pfam ID: PF00010
• Sequence:
  MERVKMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSG
  SSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLE
  EAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVD
  VESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSFTS
• Function: Transcriptional repressor. MXI1 binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. MXI1 thus antagonizes MYC transcriptional activity by competing for MAX.
• Tissue Specificity: High levels found in the brain, heart and lung while lower levels are seen in the liver, kidney and skeletal muscle.

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neuroblastoma	DISVZBI4	Definitive	Altered Expression	[1]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[2]
B-cell lymphoma	DISIH1YQ	Strong	Altered Expression	[3]
Bladder cancer	DISUHNM0	Strong	Biomarker	[4]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[5]
Breast adenocarcinoma	DISMPHJ0	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[8]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[9]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[10]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[11]
Glioma	DIS5RPEH	Strong	Biomarker	[12]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[15]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[16]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Biomarker	[17]
Nephropathy	DISXWP4P	Strong	Biomarker	[18]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[5]
Prostate cancer	DISF190Y	Strong	Biomarker	[19]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[20]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[19]
Retinoblastoma	DISVPNPB	Strong	Altered Expression	[21]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[22]
Small-cell lung cancer	DISK3LZD	Strong	Biomarker	[23]
Thrombocytopenia	DISU61YW	Strong	Altered Expression	[16]
Ulcerative colitis	DIS8K27O	Strong	Altered Expression	[24]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[4]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[4]
Adult glioblastoma	DISVP4LU	moderate	Genetic Variation	[25]
Breast carcinoma	DIS2UE88	moderate	Altered Expression	[7]
Carcinoma	DISH9F1N	moderate	Biomarker	[26]
Gastric cancer	DISXGOUK	moderate	Altered Expression	[27]
Glioblastoma multiforme	DISK8246	moderate	Genetic Variation	[25]
Lung cancer	DISCM4YA	moderate	Altered Expression	[28]
Lung carcinoma	DISTR26C	moderate	Altered Expression	[28]
Polycystic kidney disease	DISWS3UY	moderate	Posttranslational Modification	[29]
Squamous cell carcinoma	DISQVIFL	moderate	Biomarker	[30]
Stomach cancer	DISKIJSX	moderate	Altered Expression	[27]
Medulloblastoma	DISZD2ZL	Disputed	Biomarker	[31]
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[32]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Biomarker	[23]
Ovarian cancer	DISZJHAP	Limited	Biomarker	[33]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[33]

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Max-interacting protein 1 (MXI1) affects the response to substance of Fluorouracil.	[55]
Etoposide	DMNH3PG	Approved	Max-interacting protein 1 (MXI1) affects the response to substance of Etoposide.	[55]
Mitoxantrone	DMM39BF	Approved	Max-interacting protein 1 (MXI1) affects the response to substance of Mitoxantrone.	[55]
Cyclophosphamide	DM4O2Z7	Approved	Max-interacting protein 1 (MXI1) affects the response to substance of Cyclophosphamide.	[55]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Max-interacting protein 1 (MXI1).	[34]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Max-interacting protein 1 (MXI1).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin affects the expression of Max-interacting protein 1 (MXI1).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Max-interacting protein 1 (MXI1).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Max-interacting protein 1 (MXI1).	[38]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Max-interacting protein 1 (MXI1).	[39]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Max-interacting protein 1 (MXI1).	[40]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Max-interacting protein 1 (MXI1).	[41]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Max-interacting protein 1 (MXI1).	[42]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Max-interacting protein 1 (MXI1).	[43]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Max-interacting protein 1 (MXI1).	[38]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Max-interacting protein 1 (MXI1).	[44]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of Max-interacting protein 1 (MXI1).	[38]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Max-interacting protein 1 (MXI1).	[38]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of Max-interacting protein 1 (MXI1).	[45]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil decreases the expression of Max-interacting protein 1 (MXI1).	[38]
2-deoxyglucose	DMIAHVU	Approved	2-deoxyglucose decreases the expression of Max-interacting protein 1 (MXI1).	[45]
Bleomycin	DMNER5S	Approved	Bleomycin decreases the expression of Max-interacting protein 1 (MXI1).	[45]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Max-interacting protein 1 (MXI1).	[46]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of Max-interacting protein 1 (MXI1).	[47]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Max-interacting protein 1 (MXI1).	[49]
Scriptaid	DM9JZ21	Preclinical	Scriptaid increases the expression of Max-interacting protein 1 (MXI1).	[45]
Oxamflatin	DM1TG3C	Terminated	Oxamflatin increases the expression of Max-interacting protein 1 (MXI1).	[45]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Max-interacting protein 1 (MXI1).	[51]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Max-interacting protein 1 (MXI1).	[42]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Max-interacting protein 1 (MXI1).	[52]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Max-interacting protein 1 (MXI1).	[53]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Max-interacting protein 1 (MXI1).	[54]
Apicidin	DM83WVF	Investigative	Apicidin increases the expression of Max-interacting protein 1 (MXI1).	[45]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Max-interacting protein 1 (MXI1).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Max-interacting protein 1 (MXI1).	[50]

References

• [1] N-Myc differentially regulates expression of MXI1 isoforms in neuroblastoma.Neoplasia. 2013 Dec;15(12):1363-70. doi: 10.1593/neo.11606.
• [2] Overexpression of MAD2 predicts clinical outcome in primary lung cancer patients.Lung Cancer. 2011 Oct;74(1):124-31. doi: 10.1016/j.lungcan.2011.01.025. Epub 2011 Mar 4.
• [3] Mad2 overexpression is associated with high cell proliferation and reduced disease-free survival in primary gastrointestinal diffuse large B-cell lymphoma.Hematology. 2016 Aug;21(7):399-403. doi: 10.1080/10245332.2015.1101970. Epub 2016 Mar 16.
• [4] Elevated TRIP13 drives cell proliferation and drug resistance in bladder cancer.Am J Transl Res. 2019 Jul 15;11(7):4397-4410. eCollection 2019.
• [5] An integrative analysis of DNA methylation in osteosarcoma.J Bone Oncol. 2017 May 19;9:34-40. doi: 10.1016/j.jbo.2017.05.001. eCollection 2017 Nov.
• [6] Mxi1 is a potential cellular target of carcinogens and frequently mutated in experimental rat tumors and tumor cell lines.Pathol Int. 2000 May;50(5):373-83. doi: 10.1046/j.1440-1827.2000.01057.x.
• [7] Novel Mad2-targeting miR-493-3p controls mitotic fidelity and cancer cells' sensitivity to paclitaxel.Oncotarget. 2016 Mar 15;7(11):12267-85. doi: 10.18632/oncotarget.7860.
• [8] Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
• [9] miR-28-5p promotes chromosomal instability in VHL-associated cancers by inhibiting Mad2 translation.Cancer Res. 2014 May 1;74(9):2432-43. doi: 10.1158/0008-5472.CAN-13-2041. Epub 2014 Feb 3.
• [10] Therapeutic targeting of the mitotic spindle checkpoint through nanoparticle-mediated siRNA delivery inhibits tumor growth in vivo.Cancer Lett. 2011 May 28;304(2):128-36. doi: 10.1016/j.canlet.2011.02.014. Epub 2011 Mar 5.
• [11] BRCA1 and MAD2 Are Coexpressed and Are Prognostic Indicators in Tubo-ovarian High-Grade Serous Carcinoma.Int J Gynecol Cancer. 2018 Mar;28(3):472-478. doi: 10.1097/IGC.0000000000001214.
• [12] MAD2-p31(comet) axis deficiency reduces cell proliferation, migration and sensitivity of microtubule-interfering agents in glioma.Biochem Biophys Res Commun. 2018 Mar 25;498(1):157-163. doi: 10.1016/j.bbrc.2018.02.011. Epub 2018 Feb 3.
• [13] Pilot study of mucosal genetic differences in early smokers and nonsmokers.Laryngoscope. 2006 Aug;116(8):1375-9. doi: 10.1097/01.mlg.0000228133.08067.f8.
• [14] A positive feedback loop between ROS and Mxi1-0 promotes hypoxia-induced VEGF expression in human hepatocellular carcinoma cells.Cell Signal. 2017 Feb;31:79-86. doi: 10.1016/j.cellsig.2017.01.007. Epub 2017 Jan 6.
• [15] Upregulation of Mad2 facilitates invivo and invitro osteosarcoma progression.Oncol Rep. 2012 Dec;28(6):2170-6. doi: 10.3892/or.2012.2032. Epub 2012 Sep 17.
• [16] Prognostic importance of Aurora Kinases and mitotic spindle genes transcript levels in Myelodysplastic syndrome.Leuk Res. 2018 Jan;64:61-70. doi: 10.1016/j.leukres.2017.11.013. Epub 2017 Nov 28.
• [17] Mitotic arrest deficient 2 expression induces chemosensitization to a DNA-damaging agent, cisplatin, in nasopharyngeal carcinoma cells.Cancer Res. 2005 Feb 15;65(4):1450-8. doi: 10.1158/0008-5472.CAN-04-0567.
• [18] Inactivation of max-interacting protein 1 induces renal cilia disassembly through reduction in levels of intraflagellar transport 20 in polycystic kidney.J Biol Chem. 2013 Mar 1;288(9):6488-97. doi: 10.1074/jbc.M112.413302. Epub 2013 Jan 13.
• [19] Mxi1, a Myc antagonist, suppresses proliferation of DU145 human prostate cells.Prostate. 2001 May 15;47(3):194-204. doi: 10.1002/pros.1063.
• [20] Commonly occurring loss and mutation of the MXI1 gene in prostate cancer.Genes Chromosomes Cancer. 1998 Aug;22(4):295-304.
• [21] Inhibition of Skp2 sensitizes lung cancer cells to paclitaxel.Onco Targets Ther. 2017 Jan 18;10:439-446. doi: 10.2147/OTT.S125789. eCollection 2017.
• [22] Mitotic slippage: an old tale with a new twist.Cell Cycle. 2019 Jan;18(1):7-15. doi: 10.1080/15384101.2018.1559557. Epub 2019 Jan 2.
• [23] MAD2 Combined with Mitotic Spindle Apparatus (MSA) and Anticentromere Antibody (ACA) for Diagnosis of Small Cell Lung Cancer (SCLC).Med Sci Monit. 2018 Oct 22;24:7541-7547. doi: 10.12659/MSM.909772.
• [24] Spindle proteins Aurora A and BUB1B, but not Mad2, are aberrantly expressed in dysplastic mucosa of patients with longstanding ulcerative colitis.J Clin Pathol. 2007 Dec;60(12):1403-8. doi: 10.1136/jcp.2006.044305. Epub 2007 Feb 23.
• [25] Identification and characterization of lncRNA mediated transcriptional dysregulation dictates lncRNA roles in glioblastoma.Oncotarget. 2016 Jul 19;7(29):45027-45041. doi: 10.18632/oncotarget.7801.
• [26] High expression of spindle assembly checkpoint proteins CDC20 and MAD2 is associated with poor prognosis in urothelial bladder cancer.Virchows Arch. 2013 Nov;463(5):681-7. doi: 10.1007/s00428-013-1473-6. Epub 2013 Aug 31.
• [27] Spindle assembly checkpoint MAD2 and CDC20 overexpressions and cell-in-cell formation in gastric cancer and its precursor lesions.Hum Pathol. 2019 Mar;85:174-183. doi: 10.1016/j.humpath.2018.10.029. Epub 2018 Nov 15.
• [28] S6K1 phosphorylation-dependent degradation of Mxi1 by -Trcp ubiquitin ligase promotes Myc activation and radioresistance in lung cancer.Theranostics. 2018 Feb 2;8(5):1286-1300. doi: 10.7150/thno.22552. eCollection 2018.
• [29] Identification of apolipoproteinA1 reduction in the polycystic kidney by proteomics analysis of the Mxi1-deficient mouse.Proteomics. 2009 Aug;9(15):3824-32. doi: 10.1002/pmic.200800753.
• [30] MAD2 expression in oral squamous cell carcinoma and its relationship to tumor grade and proliferation.Anticancer Res. 2014 Dec;34(12):7021-7.
• [31] MAX and MYC: a heritable breakup.Cancer Res. 2012 Jul 1;72(13):3119-24. doi: 10.1158/0008-5472.CAN-11-3891. Epub 2012 Jun 15.
• [32] Mad2 and p27 expression profiles in colorectal cancer and its clinical significance.World J Gastroenterol. 2004 Nov 1;10(21):3218-20. doi: 10.3748/wjg.v10.i21.3218.
• [33] The impact of microRNA expression on cellular proliferation.Hum Genet. 2014 Jul;133(7):931-8. doi: 10.1007/s00439-014-1434-4. Epub 2014 Mar 8.
• [34] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [35] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [36] Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [39] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [40] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [41] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [42] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [43] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [44] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [45] Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
• [46] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [47] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [48] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [49] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [50] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [51] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [52] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [53] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [54] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [55] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.