Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1MDLA1)

DOT Name Cyclic AMP-responsive element-binding protein 1 (CREB1)
Synonyms CREB-1; cAMP-responsive element-binding protein 1
Gene Name CREB1
UniProt ID
CREB1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2LXT; 5ZK1; 5ZKO; 7TBH
Pfam ID
PF00170 ; PF02173
Sequence
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
Function
Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters. Transcription activation is enhanced by the TORC coactivators which act independently of Ser-119 phosphorylation. Involved in different cellular processes including the synchronization of circadian rhythmicity and the differentiation of adipose cells. Regulates the expression of apoptotic and inflammatory response factors in cardiomyocytes in response to ERFE-mediated activation of AKT signaling.
KEGG Pathway
cGMP-PKG sig.ling pathway (hsa04022 )
cAMP sig.ling pathway (hsa04024 )
Efferocytosis (hsa04148 )
PI3K-Akt sig.ling pathway (hsa04151 )
AMPK sig.ling pathway (hsa04152 )
Longevity regulating pathway (hsa04211 )
Adrenergic sig.ling in cardiomyocytes (hsa04261 )
Osteoclast differentiation (hsa04380 )
Antigen processing and presentation (hsa04612 )
TNF sig.ling pathway (hsa04668 )
Circadian rhythm (hsa04710 )
Circadian entrainment (hsa04713 )
Thermogenesis (hsa04714 )
Cholinergic sy.pse (hsa04725 )
Dopaminergic sy.pse (hsa04728 )
Insulin secretion (hsa04911 )
Estrogen sig.ling pathway (hsa04915 )
Melanogenesis (hsa04916 )
Thyroid hormone synthesis (hsa04918 )
Glucagon sig.ling pathway (hsa04922 )
Renin secretion (hsa04924 )
Aldosterone synthesis and secretion (hsa04925 )
Relaxin sig.ling pathway (hsa04926 )
Cortisol synthesis and secretion (hsa04927 )
Parathyroid hormone synthesis, secretion and action (hsa04928 )
Insulin resistance (hsa04931 )
Cushing syndrome (hsa04934 )
Growth hormone synthesis, secretion and action (hsa04935 )
Vasopressin-regulated water reabsorption (hsa04962 )
Huntington disease (hsa05016 )
Prion disease (hsa05020 )
Cocaine addiction (hsa05030 )
Amphetamine addiction (hsa05031 )
Alcoholism (hsa05034 )
Tuberculosis (hsa05152 )
Hepatitis B (hsa05161 )
Human cytomegalovirus infection (hsa05163 )
Human papillomavirus infection (hsa05165 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Viral carcinogenesis (hsa05203 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Prostate cancer (hsa05215 )
Reactome Pathway
CaMK IV-mediated phosphorylation of CREB (R-HSA-111932 )
AKT phosphorylates targets in the nucleus (R-HSA-198693 )
CREB phosphorylation (R-HSA-199920 )
Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201 )
NOTCH2 intracellular domain regulates transcription (R-HSA-2197563 )
NCAM signaling for neurite out-growth (R-HSA-375165 )
Circadian Clock (R-HSA-400253 )
CREB1 phosphorylation through the activation of Adenylate Cyclase (R-HSA-442720 )
CREB1 phosphorylation through the activation of CaMKII/CaMKK/CaMKIV cascasde (R-HSA-442729 )
CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling (R-HSA-442742 )
Constitutive Signaling by AKT1 E17K in Cancer (R-HSA-5674400 )
Gastrin-CREB signalling pathway via PKC and MAPK (R-HSA-881907 )
Regulation of MECP2 expression and activity (R-HSA-9022692 )
MECP2 regulates neuronal receptors and channels (R-HSA-9022699 )
MECP2 regulates transcription of neuronal ligands (R-HSA-9022702 )
MECP2 regulates transcription factors (R-HSA-9022707 )
NGF-stimulated transcription (R-HSA-9031628 )
HCMV Early Events (R-HSA-9609690 )
Transcriptional regulation of granulopoiesis (R-HSA-9616222 )
Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638 )
ADORA2B mediated anti-inflammatory cytokines production (R-HSA-9660821 )
FCGR3A-mediated IL10 synthesis (R-HSA-9664323 )
Heme signaling (R-HSA-9707616 )
PKA-mediated phosphorylation of CREB (R-HSA-111931 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Aspirin DM672AH Approved Cyclic AMP-responsive element-binding protein 1 (CREB1) increases the Completed suicide ADR of Aspirin. [49]
------------------------------------------------------------------------------------
37 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [1]
Dexamethasone DMMWZET Approved Dexamethasone increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [8]
Cannabidiol DM0659E Approved Cannabidiol increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [10]
Isotretinoin DM4QTBN Approved Isotretinoin increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [2]
Troglitazone DM3VFPD Approved Troglitazone decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [11]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [12]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [11]
Ethanol DMDRQZU Approved Ethanol increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [13]
Alitretinoin DMME8LH Approved Alitretinoin increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [2]
Daunorubicin DMQUSBT Approved Daunorubicin decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [17]
Dinoprostone DMTYOPD Approved Dinoprostone increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [18]
Vitamin A DMJ2AH4 Approved Vitamin A increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [2]
Ergotidine DM78IME Approved Ergotidine decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [21]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [23]
Dalcetrapib DMKNCVM Phase 3 Dalcetrapib decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [25]
Anacetrapib DMP2BFG Phase 3 Anacetrapib increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [25]
LY294002 DMY1AFS Phase 1 LY294002 decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [23]
Sphingosine-1-Phosphate DMJCQKA Phase 1 Sphingosine-1-Phosphate increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [27]
TDZD-8 DMG6Q45 Patented TDZD-8 increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [29]
SB 203580 DMAET6F Terminated SB 203580 decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [23]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [30]
Coumarin DM0N8ZM Investigative Coumarin affects the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [33]
Lithium chloride DMHYLQ2 Investigative Lithium chloride increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [37]
Forskolin DM6ITNG Investigative Forskolin increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [38]
acrolein DMAMCSR Investigative acrolein increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [39]
BRN-3548355 DM4KXT0 Investigative BRN-3548355 increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [40]
PD98059 DMZC90M Investigative PD98059 decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [42]
15-deoxy-Delta(12, 14)-prostaglandin J(2) DM8VUX3 Investigative 15-deoxy-Delta(12, 14)-prostaglandin J(2) decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [11]
Dorsomorphin DMKYXJW Investigative Dorsomorphin increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [43]
Tetramethylbutylphenol DMW9CH2 Investigative Tetramethylbutylphenol increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [44]
2,6-Dihydroanthra/1,9-Cd/Pyrazol-6-One DMDN12L Investigative 2,6-Dihydroanthra/1,9-Cd/Pyrazol-6-One decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [23]
Anandamide DMCKH3P Investigative Anandamide decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [45]
2-Methylamino-succinic acid(NMDA) DMKP6BM Investigative 2-Methylamino-succinic acid(NMDA) decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [46]
Selumetinib DMC7W6R Investigative Selumetinib decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [42]
EGTA DMW9MRO Investigative EGTA decreases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [47]
xamoterol DMOVJP3 Investigative xamoterol increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [40]
SB-415286 DMMAL3I Investigative SB-415286 increases the phosphorylation of Cyclic AMP-responsive element-binding protein 1 (CREB1). [48]
------------------------------------------------------------------------------------
⏷ Show the Full List of 37 Drug(s)
32 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the activity of Cyclic AMP-responsive element-binding protein 1 (CREB1). [2]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [3]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [4]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [5]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [6]
Selenium DM25CGV Approved Selenium decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [7]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [9]
Nicotine DMWX5CO Approved Nicotine decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [14]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [15]
Methamphetamine DMPM4SK Approved Methamphetamine increases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [16]
Adenosine DMM2NSK Approved Adenosine increases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [19]
Mitotane DMU1GX0 Approved Mitotane increases the activity of Cyclic AMP-responsive element-binding protein 1 (CREB1). [20]
Cabergoline DMQ4HIN Approved Cabergoline increases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [22]
Tamibarotene DM3G74J Phase 3 Tamibarotene affects the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [24]
Phenol DM1QSM3 Phase 2/3 Phenol increases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [15]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [7]
DNCB DMDTVYC Phase 2 DNCB affects the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [15]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the activity of Cyclic AMP-responsive element-binding protein 1 (CREB1). [20]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [14]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [28]
Eugenol DM7US1H Patented Eugenol affects the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [15]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [31]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [32]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [34]
Glyphosate DM0AFY7 Investigative Glyphosate decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [35]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [36]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde decreases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [15]
Cordycepin DM72Y01 Investigative Cordycepin increases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [19]
OXYBENZONE DMMZYX6 Investigative OXYBENZONE increases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [41]
NSC-1771 DMNXDGQ Investigative NSC-1771 increases the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [15]
methyl salicylate DMKCG8H Investigative methyl salicylate affects the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [15]
Aminobenzoic acid DMNGW2M Investigative Aminobenzoic acid affects the expression of Cyclic AMP-responsive element-binding protein 1 (CREB1). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 32 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
PIPERINE DMYEAB1 Phase 1/2 PIPERINE decreases the localization of Cyclic AMP-responsive element-binding protein 1 (CREB1). [26]
------------------------------------------------------------------------------------

References

1 Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
2 Nonclassical action of retinoic acid on the activation of the cAMP response element-binding protein in normal human bronchial epithelial cells. Mol Biol Cell. 2006 Feb;17(2):566-75. doi: 10.1091/mbc.e05-06-0519. Epub 2005 Nov 9.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
6 Distinct genetic profile in peripheral blood mononuclear cells of psoriatic arthritis patients treated with methotrexate and TNF-inhibitors. Clin Rheumatol. 2014 Dec;33(12):1815-21. doi: 10.1007/s10067-014-2807-8. Epub 2014 Oct 24.
7 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
8 PKA-dependent growth stimulation of cells derived from human pulmonary adenocarcinoma and small airway epithelium by dexamethasone. Eur J Cancer. 2005 Nov;41(17):2745-53. doi: 10.1016/j.ejca.2005.09.001. Epub 2005 Oct 18.
9 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
10 Cannabidiol upregulates melanogenesis through CB1 dependent pathway by activating p38 MAPK and p42/44 MAPK. Chem Biol Interact. 2017 Aug 1;273:107-114. doi: 10.1016/j.cbi.2017.06.005. Epub 2017 Jun 7.
11 Peroxisome proliferator-activated receptor-gamma ligands suppress fibronectin gene expression in human lung carcinoma cells: involvement of both CRE and Sp1. Am J Physiol Lung Cell Mol Physiol. 2005 Sep;289(3):L419-28. doi: 10.1152/ajplung.00002.2005. Epub 2005 May 20.
12 p38 MAPK/PP2Ac/TTP pathway on the connection of TNF- and caspases activation on hydroquinone-induced apoptosis. Carcinogenesis. 2013 Apr;34(4):818-27. doi: 10.1093/carcin/bgs409. Epub 2013 Jan 3.
13 NCX3 alleviates ethanol-induced apoptosis of SK-N-SH cells via the elimination of intracellular calcium ions. Toxicol In Vitro. 2021 Apr;72:105104. doi: 10.1016/j.tiv.2021.105104. Epub 2021 Jan 28.
14 Effects of tobacco compounds on gene expression in fetal lung fibroblasts. Environ Toxicol. 2008 Aug;23(4):423-34.
15 Gene markers in dendritic cells unravel pieces of the skin sensitization puzzle. Toxicol Lett. 2010 Jul 1;196(2):95-103. doi: 10.1016/j.toxlet.2010.04.003. Epub 2010 Apr 10.
16 Inhibition of PLC1 signaling pathway regulates methamphetamine self-administration and neurotoxicity in rats. Food Chem Toxicol. 2021 Mar;149:111970. doi: 10.1016/j.fct.2021.111970. Epub 2021 Jan 7.
17 CREB/Sp1-mediated MCL1 expression and NFB-mediated ABCB1 expression modulate the cytotoxicity of daunorubicin in chronic myeloid leukemia cells. Toxicol Appl Pharmacol. 2022 Jan 15;435:115847. doi: 10.1016/j.taap.2021.115847. Epub 2021 Dec 25.
18 Ketoconazole suppresses prostaglandin E(2)-induced cyclooxygenase-2 expression in human epidermoid carcinoma A-431 cells. J Invest Dermatol. 2002 Jul;119(1):174-81.
19 Adenosine and Cordycepin Accelerate Tissue Remodeling Process through Adenosine Receptor Mediated Wnt/-Catenin Pathway Stimulation by Regulating GSK3b Activity. Int J Mol Sci. 2021 May 25;22(11):5571. doi: 10.3390/ijms22115571.
20 Organochlorine-mediated potentiation of the general coactivator p300 through p38 mitogen-activated protein kinase. Carcinogenesis. 2009 Jan;30(1):106-13. doi: 10.1093/carcin/bgn213. Epub 2008 Sep 12.
21 Glycyrrhizin attenuates histamine-mediated MUC5AC upregulation, inflammatory cytokine production, and aquaporin 5 downregulation through suppressing the NF-B pathway in human nasal epithelial cells. Chem Biol Interact. 2018 Apr 1;285:21-26. doi: 10.1016/j.cbi.2018.02.010. Epub 2018 Feb 13.
22 Atractylon, a novel dopamine 2 receptor agonist, ameliorates Parkinsonian like motor dysfunctions in MPTP-induced mice. Neurotoxicology. 2022 Mar;89:121-126. doi: 10.1016/j.neuro.2022.01.010. Epub 2022 Jan 31.
23 Upregulation of miR-328 and inhibition of CREB-DNA-binding activity are critical for resveratrol-mediated suppression of matrix metalloproteinase-2 and subsequent metastatic ability in human osteosarcomas. Oncotarget. 2015 Feb 20;6(5):2736-53. doi: 10.18632/oncotarget.3088.
24 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
25 Cholesteryl ester-transfer protein inhibitors stimulate aldosterone biosynthesis in adipocytes through Nox-dependent processes. J Pharmacol Exp Ther. 2015 Apr;353(1):27-34.
26 Piperine is a potent inhibitor of nuclear factor-kappaB (NF-kappaB), c-Fos, CREB, ATF-2 and proinflammatory cytokine gene expression in B16F-10 melanoma cells. Int Immunopharmacol. 2004 Dec 20;4(14):1795-803. doi: 10.1016/j.intimp.2004.08.005.
27 Prostacyclin induction by high-density lipoprotein (HDL) in vascular smooth muscle cells depends on sphingosine 1-phosphate receptors: effect of simvastatin. Thromb Haemost. 2008 Jul;100(1):119-26.
28 Prenatal caffeine exposure induced a lower level of fetal blood leptin mainly via placental mechanism. Toxicol Appl Pharmacol. 2015 Nov 15;289(1):109-16. doi: 10.1016/j.taap.2015.09.007. Epub 2015 Sep 12.
29 Forecasting cell death dose-response from early signal transduction responses in vitro. Toxicol Sci. 2014 Aug 1;140(2):338-51. doi: 10.1093/toxsci/kfu089. Epub 2014 May 13.
30 Bisphenol A Induces Sox2 in ER(+) Breast Cancer Stem-Like Cells. Horm Cancer. 2017 Apr;8(2):90-99. doi: 10.1007/s12672-017-0286-5. Epub 2017 Feb 27.
31 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
32 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
33 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
34 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
35 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
36 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
37 Zebularine suppresses the apoptotic potential of 5-fluorouracil via cAMP/PKA/CREB pathway against human oral squamous cell carcinoma cells. Cancer Chemother Pharmacol. 2009 Jul;64(2):223-32.
38 Post-transcriptional regulation of melanin biosynthetic enzymes by cAMP and resveratrol in human melanocytes. J Invest Dermatol. 2007 Sep;127(9):2216-27. doi: 10.1038/sj.jid.5700840. Epub 2007 Apr 26.
39 Differential regulation of c-jun and CREB by acrolein and 4-hydroxynonenal. Free Radic Biol Med. 2006 Jan 1;40(1):21-34. doi: 10.1016/j.freeradbiomed.2005.08.023. Epub 2005 Sep 2.
40 NNK activates ERK1/2 and CREB/ATF-1 via beta-1-AR and EGFR signaling in human lung adenocarcinoma and small airway epithelial cells. Int J Cancer. 2006 Oct 1;119(7):1547-52. doi: 10.1002/ijc.21987.
41 Chromatin modifiers: A new class of pollutants with potential epigenetic effects revealed by in vitro assays and transcriptomic analyses. Toxicology. 2023 Jan 15;484:153413. doi: 10.1016/j.tox.2022.153413. Epub 2022 Dec 26.
42 Ursonic acid exerts inhibitory effects on matrix metalloproteinases via ERK signaling pathway. Chem Biol Interact. 2020 Jan 5;315:108910. doi: 10.1016/j.cbi.2019.108910. Epub 2019 Nov 29.
43 Reversal of P-glycoprotein-mediated multidrug resistance is induced by mollugin in MCF-7/adriamycin cells. Phytomedicine. 2013 May 15;20(7):622-31.
44 Oncogenic Potential of Bisphenol A and Common Environmental Contaminants in Human Mammary Epithelial Cells. Int J Mol Sci. 2020 May 25;21(10):3735. doi: 10.3390/ijms21103735.
45 Anandamide down-regulates placental transporter expression through CB2 receptor-mediated inhibition of cAMP synthesis. Pharmacol Res. 2019 Mar;141:331-342. doi: 10.1016/j.phrs.2019.01.002. Epub 2019 Jan 2.
46 Kukoamine B, an amide alkaloid, protects against NMDA-induced neurotoxicity and potential mechanisms in vitro. Neurochem Int. 2015 Aug;87:66-76. doi: 10.1016/j.neuint.2015.06.001. Epub 2015 Jun 9.
47 tBHQ-induced HO-1 expression is mediated by calcium through regulation of Nrf2 binding to enhancer and polymerase II to promoter region of HO-1. Chem Res Toxicol. 2011 May 16;24(5):670-6.
48 Sirt1 inhibits the transcription factor CREB to regulate pituitary growth hormone synthesis. FASEB J. 2013 Apr;27(4):1561-71. doi: 10.1096/fj.12-220129. Epub 2013 Jan 4.
49 Association between treatment-emergent suicidal ideation with citalopram and polymorphisms near cyclic adenosine monophosphate response element binding protein in the STAR*D study. Arch Gen Psychiatry. 2007 Jun;64(6):689-97. doi: 10.1001/archpsyc.64.6.689.