Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3MT9HJ)

• DOT Name: Fos-related antigen 2 (FOSL2)
• Synonyms: FRA-2
• Gene Name: FOSL2
• UniProt ID: FOSL2_HUMAN
• Pfam ID: PF00170
• Sequence:
  MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDL
  QWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS
  PEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKL
  EFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDK
  AQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESC
  SKAHRRSSSSGDQSSDSLNSPTLLAL
• Function: Controls osteoclast survival and size. As a dimer with JUN, activates LIF transcription. Activates CEBPB transcription in PGE2-activated osteoblasts.
• KEGG Pathway: Osteoclast differentiation (hsa04380)

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Fos-related antigen 2 (FOSL2).	[1]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Fos-related antigen 2 (FOSL2).	[25]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Fos-related antigen 2 (FOSL2).	[31]

35 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Fos-related antigen 2 (FOSL2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Fos-related antigen 2 (FOSL2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Fos-related antigen 2 (FOSL2).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Fos-related antigen 2 (FOSL2).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Fos-related antigen 2 (FOSL2).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Fos-related antigen 2 (FOSL2).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Fos-related antigen 2 (FOSL2).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Fos-related antigen 2 (FOSL2).	[9]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Fos-related antigen 2 (FOSL2).	[10]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Fos-related antigen 2 (FOSL2).	[11]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Fos-related antigen 2 (FOSL2).	[12]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Fos-related antigen 2 (FOSL2).	[13]
Marinol	DM70IK5	Approved	Marinol increases the expression of Fos-related antigen 2 (FOSL2).	[14]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Fos-related antigen 2 (FOSL2).	[7]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Fos-related antigen 2 (FOSL2).	[15]
Gemcitabine	DMSE3I7	Approved	Gemcitabine decreases the expression of Fos-related antigen 2 (FOSL2).	[16]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Fos-related antigen 2 (FOSL2).	[7]
Amphetamine	DMSZQAK	Approved	Amphetamine decreases the expression of Fos-related antigen 2 (FOSL2).	[15]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Fos-related antigen 2 (FOSL2).	[17]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Fos-related antigen 2 (FOSL2).	[18]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Fos-related antigen 2 (FOSL2).	[19]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Fos-related antigen 2 (FOSL2).	[20]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Fos-related antigen 2 (FOSL2).	[21]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Fos-related antigen 2 (FOSL2).	[22]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Fos-related antigen 2 (FOSL2).	[23]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Fos-related antigen 2 (FOSL2).	[24]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Fos-related antigen 2 (FOSL2).	[26]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Fos-related antigen 2 (FOSL2).	[20]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Fos-related antigen 2 (FOSL2).	[27]
UNC0379	DMD1E4J	Preclinical	UNC0379 decreases the expression of Fos-related antigen 2 (FOSL2).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Fos-related antigen 2 (FOSL2).	[29]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Fos-related antigen 2 (FOSL2).	[30]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Fos-related antigen 2 (FOSL2).	[32]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Fos-related antigen 2 (FOSL2).	[33]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Fos-related antigen 2 (FOSL2).	[34]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [8] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [11] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [12] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [13] Gene induction and apoptosis in human hepatocellular carci-noma cells SMMC-7721 exposed to 5-aza-2'-deoxycytidine. Chin Med J (Engl). 2007 Sep 20;120(18):1626-31.
• [14] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [15] Effect of acute and chronic psychostimulant drugs on redox status, AP-1 activation and pro-enkephalin mRNA in the human astrocyte-like U373 MG cells. Neuropharmacology. 2005 Apr;48(5):673-84. doi: 10.1016/j.neuropharm.2004.12.010.
• [16] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [17] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [18] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [19] Curcumin downregulates the inflammatory cytokines CXCL1 and -2 in breast cancer cells via NFkappaB. Carcinogenesis. 2008 Apr;29(4):779-89.
• [20] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [21] Curcumin suppresses AP1 transcription factor-dependent differentiation and activates apoptosis in human epidermal keratinocytes. J Biol Chem. 2007 Mar 2;282(9):6707-15. doi: 10.1074/jbc.M606003200. Epub 2006 Dec 5.
• [22] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [23] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [24] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [25] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [26] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [27] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [28] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [29] Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
• [30] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [31] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [32] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [33] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [34] Microarray Analysis of Gene Expression Alteration in Human Middle Ear Epithelial Cells Induced by Asian Sand Dust. Clin Exp Otorhinolaryngol. 2015 Dec;8(4):345-53. doi: 10.3342/ceo.2015.8.4.345. Epub 2015 Nov 10.