Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT41KMW4)

• DOT Name: Lathosterol oxidase (SC5D)
• Synonyms: EC 1.14.19.20; C-5 sterol desaturase; Delta(7)-sterol 5-desaturase; Delta(7)-sterol C5(6)-desaturase; Lathosterol 5-desaturase; Sterol-C5-desaturase
• Gene Name: SC5D
• Related Disease:
  Cleft palate
  Isolated cleft palate
  Lathosterolosis
  Cataract
  Epilepsy
  Intellectual disability
  Smith-Lemli-Opitz syndrome
  Temporal lobe epilepsy
• UniProt ID: SC5D_HUMAN
• EC Number: 1.14.19.20
• Pfam ID: PF04116
• Sequence:
  MDLVLRVADYYFFTPYVYPATWPEDDIFRQAISLLIVTNVGAYILYFFCATLSYYFVFDH
  ALMKHPQFLKNQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV
  VSIISFLFFTDMFIYWIHRGLHHRLVYKRLHKPHHIWKIPTPFASHAFHPIDGFLQSLPY
  HIYPFIFPLHKVVYLSLYILVNIWTISIHDGDFRVPQILQPFINGSAHHTDHHMFFDYNY
  GQYFTLWDRIGGSFKNPSSFEGKGPLSYVKEMTEGKRSSHSGNGCKNEKLFNGEFTKTE
• Function: Catalyzes a dehydrogenation to introduce C5-6 double bond into lathosterol in cholesterol biosynthesis.
• KEGG Pathway:
  Steroid biosynthesis (hsa00100)
  Metabolic pathways (hsa01100)
• Reactome Pathway:
  Cholesterol biosynthesis via desmosterol (R-HSA-6807047)
  Cholesterol biosynthesis via lathosterol (R-HSA-6807062)
  Activation of gene expression by SREBF (SREBP) (R-HSA-2426168)
• BioCyc Pathway: MetaCyc:HS03271-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cleft palate	DIS6G5TF	Definitive	Altered Expression	[1]
Isolated cleft palate	DISV80CD	Definitive	Altered Expression	[1]
Lathosterolosis	DISRSQDQ	Definitive	Autosomal recessive	[1]
Cataract	DISUD7SL	Strong	Biomarker	[2]
Epilepsy	DISBB28L	Strong	Biomarker	[3]
Intellectual disability	DISMBNXP	Strong	Biomarker	[2]
Smith-Lemli-Opitz syndrome	DISX9ZUA	Strong	Biomarker	[4]
Temporal lobe epilepsy	DISNOPXX	Strong	Altered Expression	[3]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Lathosterol oxidase (SC5D).	[5]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Lathosterol oxidase (SC5D).	[6]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Lathosterol oxidase (SC5D).	[7]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Lathosterol oxidase (SC5D).	[8]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Lathosterol oxidase (SC5D).	[9]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Lathosterol oxidase (SC5D).	[10]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Lathosterol oxidase (SC5D).	[11]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Lathosterol oxidase (SC5D).	[12]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Lathosterol oxidase (SC5D).	[13]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Lathosterol oxidase (SC5D).	[14]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Lathosterol oxidase (SC5D).	[15]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Lathosterol oxidase (SC5D).	[11]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Lathosterol oxidase (SC5D).	[16]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Lathosterol oxidase (SC5D).	[17]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Lathosterol oxidase (SC5D).	[18]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Lathosterol oxidase (SC5D).	[19]
Haloperidol	DM96SE0	Approved	Haloperidol increases the expression of Lathosterol oxidase (SC5D).	[18]
Phenytoin	DMNOKBV	Approved	Phenytoin increases the expression of Lathosterol oxidase (SC5D).	[20]
Fluoxetine	DM3PD2C	Approved	Fluoxetine increases the expression of Lathosterol oxidase (SC5D).	[21]
Olanzapine	DMPFN6Y	Approved	Olanzapine increases the expression of Lathosterol oxidase (SC5D).	[18]
Ziprasidone	DMM58JY	Approved	Ziprasidone increases the expression of Lathosterol oxidase (SC5D).	[18]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Lathosterol oxidase (SC5D).	[22]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Lathosterol oxidase (SC5D).	[23]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine increases the expression of Lathosterol oxidase (SC5D).	[18]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Lathosterol oxidase (SC5D).	[24]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Lathosterol oxidase (SC5D).	[25]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Lathosterol oxidase (SC5D).	[26]
Piperazinyl methyl quinazolinone derivative 2	DM913KS	Patented	Piperazinyl methyl quinazolinone derivative 2 increases the expression of Lathosterol oxidase (SC5D).	[27]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Lathosterol oxidase (SC5D).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Lathosterol oxidase (SC5D).	[29]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Lathosterol oxidase (SC5D).	[30]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Lathosterol oxidase (SC5D).	[31]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Lathosterol oxidase (SC5D).	[32]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride decreases the expression of Lathosterol oxidase (SC5D).	[33]
Okadaic acid	DM47CO1	Investigative	Okadaic acid decreases the expression of Lathosterol oxidase (SC5D).	[34]
PP-242	DM2348V	Investigative	PP-242 decreases the expression of Lathosterol oxidase (SC5D).	[35]
Chrysin	DM7V2LG	Investigative	Chrysin decreases the expression of Lathosterol oxidase (SC5D).	[24]

References

• [1] Lathosterolosis: an inborn error of human and murine cholesterol synthesis due to lathosterol 5-desaturase deficiency. Hum Mol Genet. 2003 Jul 1;12(13):1631-41. doi: 10.1093/hmg/ddg172.
• [2] Lathosterolosis: A Relatively Mild Case with Cataracts and Learning Difficulties.JIMD Rep. 2019;44:79-84. doi: 10.1007/8904_2018_127. Epub 2018 Aug 11.
• [3] ERG3 potassium channel-mediated suppression of neuronal intrinsic excitability and prevention of seizure generation in mice.J Physiol. 2018 Oct;596(19):4729-4752. doi: 10.1113/JP275970. Epub 2018 Sep 7.
• [4] Abnormal sterols in cholesterol-deficiency diseases cause secretory granule malformation and decreased membrane curvature.J Cell Sci. 2006 May 1;119(Pt 9):1876-85. doi: 10.1242/jcs.02906.
• [5] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [6] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [7] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [8] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [9] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [10] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [11] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [12] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [13] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [14] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [15] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [16] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [17] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [18] Drug-induced activation of SREBP-controlled lipogenic gene expression in CNS-related cell lines: marked differences between various antipsychotic drugs. BMC Neurosci. 2006 Oct 20;7:69.
• [19] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [20] Role of phenytoin in wound healing: microarray analysis of early transcriptional responses in human dermal fibroblasts. Biochem Biophys Res Commun. 2004 Feb 13;314(3):661-6. doi: 10.1016/j.bbrc.2003.12.146.
• [21] Screening autism-associated environmental factors in differentiating human neural progenitors with fractional factorial design-based transcriptomics. Sci Rep. 2023 Jun 29;13(1):10519. doi: 10.1038/s41598-023-37488-0.
• [22] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [23] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [24] Anti-inflammatory effects of dietary phenolic compounds in an in vitro model of inflamed human intestinal epithelium. Chem Biol Interact. 2010 Dec 5;188(3):659-67.
• [25] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [26] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [27] A novel circular RNA confers trastuzumab resistance in human epidermal growth factor receptor 2-positive breast cancer through regulating ferroptosis. Environ Toxicol. 2022 Jul;37(7):1597-1607. doi: 10.1002/tox.23509. Epub 2022 Mar 2.
• [28] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [29] Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.
• [30] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [31] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [32] Ochratoxin a lowers mRNA levels of genes encoding for key proteins of liver cell metabolism. Cancer Genomics Proteomics. 2008 Nov-Dec;5(6):319-32.
• [33] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [34] Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
• [35] Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.