Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4ZPK4P)

• DOT Name: Sulfhydryl oxidase 1 (QSOX1)
• Synonyms: hQSOX; EC 1.8.3.2; Quiescin Q6
• Gene Name: QSOX1
• Related Disease:
  Lung cancer
  Lung carcinoma
  Adenocarcinoma
  Advanced cancer
  Drug dependence
  Matthew-Wood syndrome
  Neoplasm
  Pancreatic adenocarcinoma
  Pancreatic cancer
  Parkinson disease
  Substance abuse
  Substance dependence
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Hepatocellular carcinoma
  Liver cirrhosis
  Pancreatic ductal carcinoma
  Patent ductus arteriosus
  Invasive breast carcinoma
  Nasopharyngeal carcinoma
• UniProt ID: QSOX1_HUMAN
• PDB ID: 3LLI; 3LLK; 3Q6O; 4IJ3
• EC Number: 1.8.3.2
• Pfam ID: PF04777 ; PF18371 ; PF18108 ; PF00085
• Sequence:
  MRRCNSGSGPPPSLLLLLLWLLAVPGANAAPRSALYSPSDPLTLLQADTVRGAVLGSRSA
  WAVEFFASWCGHCIAFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPT
  VRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFF
  ARNNEEYLALIFEKGGSYLGREVALDLSQHKGVAVRRVLNTEANVVRKFGVTDFPSCYLL
  FRNGSVSRVPVLMESRSFYTAYLQRLSGLTREAAQTTVAPTTANKIAPTVWKLADRSKIY
  MADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNEWLKR
  QKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAAR
  QNVDHSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSS
  HNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNI
  ILDFPAAGSAARRDVQNVAAAPELAMGALELESRNSTLDPGKPEMMKSPTNTTPHVPAEG
  PEASRPPKLHPGLRAAPGQEPPEHMAELQRNEQEQPLGQWHLSKRDTGAALLAESRAEKN
  RLWGPLEVRRVGRSSKQLVDIPEGQLEARAGRGRGQWLQVLGGGFSYLDISLCVGLYSLS
  FMGLLAMYTYFQAKIRALKGHAGHPAA
• Function: Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. Plays a role in disulfide bond formation in a variety of extracellular proteins. In fibroblasts, required for normal incorporation of laminin into the extracellular matrix, and thereby for normal cell-cell adhesion and cell migration.
• Tissue Specificity: Expressed in heart, placenta, lung, liver, skeletal muscle, pancreas and very weakly in brain and kidney.
• Reactome Pathway:
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  Neutrophil degranulation (R-HSA-6798695)
  Post-translational protein phosphorylation (R-HSA-8957275)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DOT

21 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Definitive	Biomarker	[1]
Lung carcinoma	DISTR26C	Definitive	Biomarker	[1]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Drug dependence	DIS9IXRC	Strong	Biomarker	[4]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[5]
Neoplasm	DISZKGEW	Strong	Biomarker	[6]
Pancreatic adenocarcinoma	DISKHX7S	Strong	Altered Expression	[7]
Pancreatic cancer	DISJC981	Strong	Altered Expression	[8]
Parkinson disease	DISQVHKL	Strong	Biomarker	[9]
Substance abuse	DIS327VW	Strong	Biomarker	[4]
Substance dependence	DISDRAAR	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	moderate	Biomarker	[10]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[10]
Breast neoplasm	DISNGJLM	moderate	Altered Expression	[11]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[12]
Liver cirrhosis	DIS4G1GX	moderate	Biomarker	[12]
Pancreatic ductal carcinoma	DIS26F9Q	moderate	Altered Expression	[13]
Patent ductus arteriosus	DIS9P8YS	moderate	Altered Expression	[13]
Invasive breast carcinoma	DISANYTW	Disputed	Biomarker	[11]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Altered Expression	[14]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[15]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[16]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[17]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[18]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Sulfhydryl oxidase 1 (QSOX1).	[19]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[20]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[21]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[22]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Sulfhydryl oxidase 1 (QSOX1).	[23]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Sulfhydryl oxidase 1 (QSOX1).	[24]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[25]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[25]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Sulfhydryl oxidase 1 (QSOX1).	[26]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[27]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Sulfhydryl oxidase 1 (QSOX1).	[28]
Gefitinib	DM15F0X	Approved	Gefitinib increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[29]
Promegestone	DMK4S8I	Approved	Promegestone increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[30]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[31]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[32]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[34]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Sulfhydryl oxidase 1 (QSOX1).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Sulfhydryl oxidase 1 (QSOX1).	[36]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Sulfhydryl oxidase 1 (QSOX1).	[37]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Sulfhydryl oxidase 1 (QSOX1).	[38]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Sulfhydryl oxidase 1 (QSOX1).	[39]

References

• [1] Quiescin Sulfhydryl Oxidase 1 (QSOX1) Secreted by Lung Cancer Cells Promotes Cancer Metastasis.Int J Mol Sci. 2018 Oct 17;19(10):3213. doi: 10.3390/ijms19103213.
• [2] Quiescin sulfhydryl oxidase 1 (QSOX1) glycosite mutation perturbs secretion but not Golgi localization.Glycobiology. 2018 Aug 1;28(8):580-591. doi: 10.1093/glycob/cwy044.
• [3] A conserved major facilitator superfamily member orchestrates a subset of O-glycosylation to aid macrophage tissue invasion.Elife. 2019 Mar 26;8:e41801. doi: 10.7554/eLife.41801.
• [4] Genome wide association for addiction: replicated results and comparisons of two analytic approaches.PLoS One. 2010 Jan 21;5(1):e8832. doi: 10.1371/journal.pone.0008832.
• [5] MicroRNA-454 regulates stromal cell derived factor-1 in the control of the growth of pancreatic ductal adenocarcinoma.Sci Rep. 2016 Mar 15;6:22793. doi: 10.1038/srep22793.
• [6] Molecular Inhibitor of QSOX1 Suppresses Tumor Growth In Vivo.Mol Cancer Ther. 2020 Jan;19(1):112-122. doi: 10.1158/1535-7163.MCT-19-0233. Epub 2019 Oct 1.
• [7] High expression of QSOX1 reduces tumorogenesis, and is associated with a better outcome for breast cancer patients.Breast Cancer Res. 2012 Oct 25;14(5):R136. doi: 10.1186/bcr3341.
• [8] HIF1 contributes to hypoxia-induced pancreatic cancer cells invasion via promoting QSOX1 expression.Cell Physiol Biochem. 2013;32(3):561-8. doi: 10.1159/000354460. Epub 2013 Aug 30.
• [9] Microarray Analysis of the Molecular Mechanism Involved in Parkinson's Disease.Parkinsons Dis. 2018 Mar 1;2018:1590465. doi: 10.1155/2018/1590465. eCollection 2018.
• [10] The emerging role of QSOX1 in cancer.Antioxid Redox Signal. 2014 Jul 20;21(3):485-96. doi: 10.1089/ars.2013.5572. Epub 2014 Feb 19.
• [11] Expression of quiescin sulfhydryl oxidase 1 is associated with a highly invasive phenotype and correlates with a poor prognosis in Luminal B breast cancer.Breast Cancer Res. 2013 Mar 28;15(2):R28. doi: 10.1186/bcr3407.
• [12] Identification of CD14 as a potential biomarker of hepatocellular carcinoma using iTRAQ quantitative proteomics.Oncotarget. 2017 Jun 28;8(37):62011-62028. doi: 10.18632/oncotarget.18782. eCollection 2017 Sep 22.
• [13] Quiescin sulfhydryl oxidase 1 promotes invasion of pancreatic tumor cells mediated by matrix metalloproteinases.Mol Cancer Res. 2011 Dec;9(12):1621-31. doi: 10.1158/1541-7786.MCR-11-0018. Epub 2011 Oct 11.
• [14] Reduced QSOX1 enhances radioresistance in nasopharyngeal carcinoma.Oncotarget. 2017 Dec 14;9(3):3230-3241. doi: 10.18632/oncotarget.23227. eCollection 2018 Jan 9.
• [15] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [16] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [17] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [18] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [19] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [20] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [21] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [22] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [23] Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
• [24] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [25] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [26] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [27] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [28] Effects of paclitaxel on proliferation and apoptosis in human acute myeloid leukemia HL-60 cells. Acta Pharmacol Sin. 2004 Mar;25(3):378-84.
• [29] Identification of genes linked to gefitinib treatment in prostate cancer cell lines with or without resistance to androgen: a clue to application of gefitinib to hormone-resistant prostate cancer. Oncol Rep. 2006 Jun;15(6):1453-60.
• [30] Short-chain fatty acids enhance nuclear receptor activity through mitogen-activated protein kinase activation and histone deacetylase inhibition. Proc Natl Acad Sci U S A. 2004 May 4;101(18):7199-204.
• [31] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [32] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [33] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [34] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [35] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [36] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [37] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [38] Identification of formaldehyde-responsive genes by suppression subtractive hybridization. Toxicology. 2008 Jan 14;243(1-2):224-35.
• [39] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.