Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5TCO3O)

DOT Name	Mitogen-activated protein kinase 14 (MAPK14)
Synonyms	MAP kinase 14; MAPK 14; EC 2.7.11.24; Cytokine suppressive anti-inflammatory drug-binding protein; CSAID-binding protein; CSBP; MAP kinase MXI2; MAX-interacting protein 2; Mitogen-activated protein kinase p38 alpha; MAP kinase p38 alpha; Stress-activated protein kinase 2a; SAPK2a
Gene Name	MAPK14
UniProt ID	MK14_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1A9U ; 1BL6 ; 1BL7 ; 1BMK ; 1DI9 ; 1IAN ; 1KV1 ; 1KV2 ; 1M7Q ; 1OUK ; 1OUY ; 1OVE ; 1OZ1 ; 1R39 ; 1R3C ; 1W7H ; 1W82 ; 1W83 ; 1W84 ; 1WBN ; 1WBO ; 1WBS ; 1WBT ; 1WBV ; 1WBW ; 1WFC ; 1YQJ ; 1ZYJ ; 1ZZ2 ; 1ZZL ; 2BAJ ; 2BAK ; 2BAL ; 2BAQ ; 2FSL ; 2FSM ; 2FSO ; 2FST ; 2GFS ; 2I0H ; 2LGC ; 2NPQ ; 2OKR ; 2ONL ; 2QD9 ; 2RG5 ; 2RG6 ; 2Y8O ; 2YIS ; 2YIW ; 2YIX ; 2ZAZ ; 2ZB0 ; 2ZB1 ; 3BV2 ; 3BV3 ; 3BX5 ; 3C5U ; 3CTQ ; 3D7Z ; 3D83 ; 3DS6 ; 3DT1 ; 3E92 ; 3E93 ; 3FC1 ; 3FI4 ; 3FKL ; 3FKN ; 3FKO ; 3FL4 ; 3FLN ; 3FLQ ; 3FLS ; 3FLW ; 3FLY ; 3FLZ ; 3FMH ; 3FMJ ; 3FMK ; 3FML ; 3FMM ; 3FMN ; 3FSF ; 3FSK ; 3GC7 ; 3GCP ; 3GCQ ; 3GCS ; 3GCU ; 3GCV ; 3GFE ; 3GI3 ; 3HA8 ; 3HEC ; 3HEG ; 3HL7 ; 3HLL ; 3HP2 ; 3HP5 ; 3HRB ; 3HUB ; 3HUC ; 3HV3 ; 3HV4 ; 3HV5 ; 3HV6 ; 3HV7 ; 3HVC ; 3IPH ; 3ITZ ; 3IW5 ; 3IW6 ; 3IW7 ; 3IW8 ; 3K3I ; 3K3J ; 3KF7 ; 3KQ7 ; 3L8S ; 3L8X ; 3LFA ; 3LFB ; 3LFC ; 3LFD ; 3LFE ; 3LFF ; 3LHJ ; 3MGY ; 3MH0 ; 3MH1 ; 3MH2 ; 3MH3 ; 3MPA ; 3MPT ; 3MVL ; 3MVM ; 3MW1 ; 3NEW ; 3NNU ; 3NNV ; 3NNW ; 3NNX ; 3NWW ; 3O8P ; 3O8T ; 3O8U ; 3OBG ; 3OBJ ; 3OC1 ; 3OCG ; 3OD6 ; 3ODY ; 3ODZ ; 3OEF ; 3PG3 ; 3QUD ; 3QUE ; 3RIN ; 3ROC ; 3S3I ; 3S4Q ; 3U8W ; 3UVP ; 3UVQ ; 3UVR ; 3ZS5 ; 3ZSG ; 3ZSH ; 3ZSI ; 3ZYA ; 4A9Y ; 4AA0 ; 4AA4 ; 4AA5 ; 4AAC ; 4DLI ; 4DLJ ; 4E5A ; 4E5B ; 4E6A ; 4E6C ; 4E8A ; 4EH2 ; 4EH3 ; 4EH4 ; 4EH5 ; 4EH6 ; 4EH7 ; 4EH8 ; 4EH9 ; 4EHV ; 4EWQ ; 4F9W ; 4F9Y ; 4FA2 ; 4GEO ; 4KIN ; 4KIP ; 4KIQ ; 4L8M ; 4R3C ; 4ZTH ; 5ETA ; 5ETC ; 5ETF ; 5ETI ; 5ML5 ; 5MTX ; 5MTY ; 5MZ3 ; 5N63 ; 5N64 ; 5N65 ; 5N66 ; 5N67 ; 5N68 ; 5O8U ; 5O8V ; 5OMG ; 5OMH ; 5TBE ; 5TCO ; 5WJJ ; 5XYX ; 5XYY ; 6ANL ; 6HWT ; 6HWU ; 6HWV ; 6M95 ; 6M9L ; 6OHD ; 6QDZ ; 6QE1 ; 6QYX ; 6RFO ; 6SFI ; 6SFJ ; 6SFK ; 6SFO ; 6TCA ; 6ZQS ; 6ZWP ; 8A8M
EC Number	2.7.11.24
Pfam ID	PF00069
Sequence	MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Function	Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK14 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as pro-inflammatory cytokines or physical stress leading to direct activation of transcription factors. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. Some of the targets are downstream kinases which are activated through phosphorylation and further phosphorylate additional targets. RPS6KA5/MSK1 and RPS6KA4/MSK2 can directly phosphorylate and activate transcription factors such as CREB1, ATF1, the NF-kappa-B isoform RELA/NFKB3, STAT1 and STAT3, but can also phosphorylate histone H3 and the nucleosomal protein HMGN1. RPS6KA5/MSK1 and RPS6KA4/MSK2 play important roles in the rapid induction of immediate-early genes in response to stress or mitogenic stimuli, either by inducing chromatin remodeling or by recruiting the transcription machinery. On the other hand, two other kinase targets, MAPKAPK2/MK2 and MAPKAPK3/MK3, participate in the control of gene expression mostly at the post-transcriptional level, by phosphorylating ZFP36 (tristetraprolin) and ELAVL1, and by regulating EEF2K, which is important for the elongation of mRNA during translation. MKNK1/MNK1 and MKNK2/MNK2, two other kinases activated by p38 MAPKs, regulate protein synthesis by phosphorylating the initiation factor EIF4E2. MAPK14 interacts also with casein kinase II, leading to its activation through autophosphorylation and further phosphorylation of TP53/p53. In the cytoplasm, the p38 MAPK pathway is an important regulator of protein turnover. For example, CFLAR is an inhibitor of TNF-induced apoptosis whose proteasome-mediated degradation is regulated by p38 MAPK phosphorylation. In a similar way, MAPK14 phosphorylates the ubiquitin ligase SIAH2, regulating its activity towards EGLN3. MAPK14 may also inhibit the lysosomal degradation pathway of autophagy by interfering with the intracellular trafficking of the transmembrane protein ATG9. Another function of MAPK14 is to regulate the endocytosis of membrane receptors by different mechanisms that impinge on the small GTPase RAB5A. In addition, clathrin-mediated EGFR internalization induced by inflammatory cytokines and UV irradiation depends on MAPK14-mediated phosphorylation of EGFR itself as well as of RAB5A effectors. Ectodomain shedding of transmembrane proteins is regulated by p38 MAPKs as well. In response to inflammatory stimuli, p38 MAPKs phosphorylate the membrane-associated metalloprotease ADAM17. Such phosphorylation is required for ADAM17-mediated ectodomain shedding of TGF-alpha family ligands, which results in the activation of EGFR signaling and cell proliferation. Another p38 MAPK substrate is FGFR1. FGFR1 can be translocated from the extracellular space into the cytosol and nucleus of target cells, and regulates processes such as rRNA synthesis and cell growth. FGFR1 translocation requires p38 MAPK activation. In the nucleus, many transcription factors are phosphorylated and activated by p38 MAPKs in response to different stimuli. Classical examples include ATF1, ATF2, ATF6, ELK1, PTPRH, DDIT3, TP53/p53 and MEF2C and MEF2A. The p38 MAPKs are emerging as important modulators of gene expression by regulating chromatin modifiers and remodelers. The promoters of several genes involved in the inflammatory response, such as IL6, IL8 and IL12B, display a p38 MAPK-dependent enrichment of histone H3 phosphorylation on 'Ser-10' (H3S10ph) in LPS-stimulated myeloid cells. This phosphorylation enhances the accessibility of the cryptic NF-kappa-B-binding sites marking promoters for increased NF-kappa-B recruitment. Phosphorylates CDC25B and CDC25C which is required for binding to 14-3-3 proteins and leads to initiation of a G2 delay after ultraviolet radiation. Phosphorylates TIAR following DNA damage, releasing TIAR from GADD45A mRNA and preventing mRNA degradation. The p38 MAPKs may also have kinase-independent roles, which are thought to be due to the binding to targets in the absence of phosphorylation. Protein O-Glc-N-acylation catalyzed by the OGT is regulated by MAPK14, and, although OGT does not seem to be phosphorylated by MAPK14, their interaction increases upon MAPK14 activation induced by glucose deprivation. This interaction may regulate OGT activity by recruiting it to specific targets such as neurofilament H, stimulating its O-Glc-N-acylation. Required in mid-fetal development for the growth of embryo-derived blood vessels in the labyrinth layer of the placenta. Also plays an essential role in developmental and stress-induced erythropoiesis, through regulation of EPO gene expression. Isoform MXI2 activation is stimulated by mitogens and oxidative stress and only poorly phosphorylates ELK1 and ATF2. Isoform EXIP may play a role in the early onset of apoptosis. Phosphorylates S100A9 at 'Thr-113'. Phosphorylates NLRP1 downstream of MAP3K20/ZAK in response to UV-B irradiation and ribosome collisions, promoting activation of the NLRP1 inflammasome and pyroptosis ; (Microbial infection) Activated by phosphorylation by M.tuberculosis EsxA in T-cells leading to inhibition of IFN-gamma production; phosphorylation is apparent within 15 minutes and is inhibited by kinase-specific inhibitors SB203580 and siRNA.
Tissue Specificity	Brain, heart, placenta, pancreas and skeletal muscle. Expressed to a lesser extent in lung, liver and kidney.
KEGG Pathway	Endocrine resistance (hsa01522 ) MAPK sig.ling pathway (hsa04010 ) Rap1 sig.ling pathway (hsa04015 ) FoxO sig.ling pathway (hsa04068 ) Sphingolipid sig.ling pathway (hsa04071 ) Oocyte meiosis (hsa04114 ) Efferocytosis (hsa04148 ) Cellular senescence (hsa04218 ) Adrenergic sig.ling in cardiomyocytes (hsa04261 ) VEGF sig.ling pathway (hsa04370 ) Osteoclast differentiation (hsa04380 ) Sig.ling pathways regulating pluripotency of stem cells (hsa04550 ) Platelet activation (hsa04611 ) Neutrophil extracellular trap formation (hsa04613 ) Toll-like receptor sig.ling pathway (hsa04620 ) NOD-like receptor sig.ling pathway (hsa04621 ) RIG-I-like receptor sig.ling pathway (hsa04622 ) C-type lectin receptor sig.ling pathway (hsa04625 ) IL-17 sig.ling pathway (hsa04657 ) Th1 and Th2 cell differentiation (hsa04658 ) Th17 cell differentiation (hsa04659 ) T cell receptor sig.ling pathway (hsa04660 ) Fc epsilon RI sig.ling pathway (hsa04664 ) TNF sig.ling pathway (hsa04668 ) Leukocyte transendothelial migration (hsa04670 ) Thermogenesis (hsa04714 ) Neurotrophin sig.ling pathway (hsa04722 ) Retrograde endocan.binoid sig.ling (hsa04723 ) Dopaminergic sy.pse (hsa04728 ) Inflammatory mediator regulation of TRP channels (hsa04750 ) GnRH sig.ling pathway (hsa04912 ) Progesterone-mediated oocyte maturation (hsa04914 ) Prolactin sig.ling pathway (hsa04917 ) Relaxin sig.ling pathway (hsa04926 ) Non-alcoholic fatty liver disease (hsa04932 ) AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 ) Growth hormone synthesis, secretion and action (hsa04935 ) Alcoholic liver disease (hsa04936 ) Amyotrophic lateral sclerosis (hsa05014 ) Prion disease (hsa05020 ) Pathways of neurodegeneration - multiple diseases (hsa05022 ) Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120 ) Pathogenic Escherichia coli infection (hsa05130 ) Shigellosis (hsa05131 ) Salmonella infection (hsa05132 ) Pertussis (hsa05133 ) Yersinia infection (hsa05135 ) Leishmaniasis (hsa05140 ) Chagas disease (hsa05142 ) Toxoplasmosis (hsa05145 ) Tuberculosis (hsa05152 ) Hepatitis B (hsa05161 ) Human cytomegalovirus infection (hsa05163 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 ) Epstein-Barr virus infection (hsa05169 ) Human immunodeficiency virus 1 infection (hsa05170 ) Coro.virus disease - COVID-19 (hsa05171 ) Proteoglycans in cancer (hsa05205 ) Chemical carcinogenesis - reactive oxygen species (hsa05208 ) PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 ) Diabetic cardiomyopathy (hsa05415 ) Lipid and atherosclerosis (hsa05417 ) Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway	p38MAPK events (R-HSA-171007 ) ERK/MAPK targets (R-HSA-198753 ) Activation of PPARGC1A (PGC-1alpha) by phosphorylation (R-HSA-2151209 ) Oxidative Stress Induced Senescence (R-HSA-2559580 ) DSCAM interactions (R-HSA-376172 ) ADP signalling through P2Y purinoceptor 1 (R-HSA-418592 ) Platelet sensitization by LDL (R-HSA-432142 ) VEGFA-VEGFR2 Pathway (R-HSA-4420097 ) activated TAK1 mediates p38 MAPK activation (R-HSA-450302 ) Activation of the AP-1 family of transcription factors (R-HSA-450341 ) KSRP (KHSRP) binds and destabilizes mRNA (R-HSA-450604 ) Myogenesis (R-HSA-525793 ) RHO GTPases Activate NADPH Oxidases (R-HSA-5668599 ) Neutrophil degranulation (R-HSA-6798695 ) Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756 ) CD163 mediating an anti-inflammatory response (R-HSA-9662834 ) NOD1/2 Signaling Pathway (R-HSA-168638 )
BioCyc Pathway	MetaCyc:HS03507-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Haloperidol	DM96SE0	Approved	Mitogen-activated protein kinase 14 (MAPK14) increases the Apoptosis ADR of Haloperidol.	[53]
Ruxolitinib	DM7Q98D	Phase 3 Trial	Mitogen-activated protein kinase 14 (MAPK14) increases the Anaemia ADR of Ruxolitinib.	[53]
Afimoxifene	DMFORDT	Phase 2	Mitogen-activated protein kinase 14 (MAPK14) decreases the response to substance of Afimoxifene.	[55]
------------------------------------------------------------------------------------

This DOT Affected the Biotransformations of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Aldosterone	DM9S2JW	Approved	Mitogen-activated protein kinase 14 (MAPK14) affects the chemical synthesis of Aldosterone.	[54]
------------------------------------------------------------------------------------

42 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of Mitogen-activated protein kinase 14 (MAPK14).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the activity of Mitogen-activated protein kinase 14 (MAPK14).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[8]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[9]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[10]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[12]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the activity of Mitogen-activated protein kinase 14 (MAPK14).	[13]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Mitogen-activated protein kinase 14 (MAPK14).	[14]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[15]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the activity of Mitogen-activated protein kinase 14 (MAPK14).	[16]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[17]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[19]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Mitogen-activated protein kinase 14 (MAPK14).	[14]
Sorafenib	DMS8IFC	Approved	Sorafenib decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[24]
Ethacrynic acid	DM60QMR	Approved	Ethacrynic acid decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[25]
Desipramine	DMT2FDC	Approved	Desipramine increases the activity of Mitogen-activated protein kinase 14 (MAPK14).	[27]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[28]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Mitogen-activated protein kinase 14 (MAPK14).	[2]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[29]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the activity of Mitogen-activated protein kinase 14 (MAPK14).	[30]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[31]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the activity of Mitogen-activated protein kinase 14 (MAPK14).	[32]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[33]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[35]
Doramapimod	DM6BU7N	Patented	Doramapimod decreases the activity of Mitogen-activated protein kinase 14 (MAPK14).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[38]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Mitogen-activated protein kinase 14 (MAPK14).	[39]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[40]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[33]
D-glucose	DMMG2TO	Investigative	D-glucose increases the activity of Mitogen-activated protein kinase 14 (MAPK14).	[42]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[43]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE affects the expression of Mitogen-activated protein kinase 14 (MAPK14).	[45]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl increases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[33]
U0126	DM31OGF	Investigative	U0126 decreases the activity of Mitogen-activated protein kinase 14 (MAPK14).	[47]
Methyl Mercury Ion	DM6YEW4	Investigative	Methyl Mercury Ion increases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[33]
Syringic Acid	DM802V7	Investigative	Syringic Acid decreases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[49]
OXYRESVERATROL	DMN7S4L	Investigative	OXYRESVERATROL increases the expression of Mitogen-activated protein kinase 14 (MAPK14).	[50]
PF-3644022	DM6KVIA	Investigative	PF-3644022 decreases the activity of Mitogen-activated protein kinase 14 (MAPK14).	[37]
------------------------------------------------------------------------------------


⏷ Show the Full List of 42 Drug(s)

18 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[6]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[11]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[18]
Aspirin	DM672AH	Approved	Aspirin increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[20]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[21]
Thalidomide	DM70BU5	Approved	Thalidomide increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[23]
Sorbitol	DMAN0DE	Approved	Sorbitol increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[26]
DNCB	DMDTVYC	Phase 2	DNCB increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[21]
Adaphostin	DM16QSG	Phase 1	Adaphostin increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[34]
PMID26560530-Compound-35	DMO36RL	Patented	PMID26560530-Compound-35 decreases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[36]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[21]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[21]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[41]
Manganese	DMKT129	Investigative	Manganese decreases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[44]
acrolein	DMAMCSR	Investigative	acrolein increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[46]
OLEANOLIC_ACID	DMWDMJ3	Investigative	OLEANOLIC_ACID decreases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[48]
Buthionine sulfoximine	DMJ46CB	Investigative	Buthionine sulfoximine increases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[51]
Talmapimod	DMMTSL2	Investigative	Talmapimod decreases the phosphorylation of Mitogen-activated protein kinase 14 (MAPK14).	[52]
------------------------------------------------------------------------------------


⏷ Show the Full List of 18 Drug(s)

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dasatinib	DMJV2EK	Approved	Dasatinib affects the binding of Mitogen-activated protein kinase 14 (MAPK14).	[22]
------------------------------------------------------------------------------------

References

1	Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
2	Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
3	Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Madecassoside ameliorates cisplatin-induced nephrotoxicity by inhibiting activation of the mitogen activated protein kinase pathway. Environ Toxicol. 2023 Jul;38(7):1473-1483. doi: 10.1002/tox.23777. Epub 2023 Apr 23.
7	Positive and negative transcriptional regulation of aromatase expression in human breast cancer tissue. J Steroid Biochem Mol Biol. 2005 May;95(1-5):17-23.
8	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9	Combined effects of arsenic and palmitic acid on oxidative stress and lipid metabolism disorder in human hepatoma HepG2 cells. Sci Total Environ. 2021 May 15;769:144849. doi: 10.1016/j.scitotenv.2020.144849. Epub 2021 Jan 19.
10	Quercetin modulates Nrf2 and glutathione-related defenses in HepG2 cells: Involvement of p38. Chem Biol Interact. 2012 Jan 25;195(2):154-64.
11	Arsenic trioxide promotes ERK1/2-mediated phosphorylation and degradation of BIM(EL) to attenuate apoptosis in BEAS-2B cells. Chem Biol Interact. 2023 Jan 5;369:110304. doi: 10.1016/j.cbi.2022.110304. Epub 2022 Dec 10.
12	Neuroprotective effects of glucomoringin-isothiocyanate against H(2)O(2)-Induced cytotoxicity in neuroblastoma (SH-SY5Y) cells. Neurotoxicology. 2019 Dec;75:89-104. doi: 10.1016/j.neuro.2019.09.008. Epub 2019 Sep 12.
13	Vitamin D3 induces autophagy in human monocytes/macrophages via cathelicidin. Cell Host Microbe. 2009 Sep 17;6(3):231-43. doi: 10.1016/j.chom.2009.08.004.
14	Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
15	Inflammation in methotrexate-induced pulmonary toxicity occurs via the p38 MAPK pathway. Toxicology. 2009 Feb 27;256(3):183-90. doi: 10.1016/j.tox.2008.11.016. Epub 2008 Nov 28.
16	Role of caspases in dexamethasone-induced apoptosis and activation of c-Jun NH2-terminal kinase and p38 mitogen-activated protein kinase in human eosinophils. Clin Exp Immunol. 2000 Oct;122(1):20-7. doi: 10.1046/j.1365-2249.2000.01344.x.
17	Gingival Stromal Cells as an In Vitro Model: Cannabidiol Modulates Genes Linked With Amyotrophic Lateral Sclerosis. J Cell Biochem. 2017 Apr;118(4):819-828. doi: 10.1002/jcb.25757. Epub 2016 Nov 28.
18	Effects of SIDT2 on the miR-25/NOX4/HuR axis and SIRT3 mRNA stability lead to ROS-mediated TNF- expression in hydroquinone-treated leukemia cells. Cell Biol Toxicol. 2023 Oct;39(5):2207-2225. doi: 10.1007/s10565-022-09705-5. Epub 2022 Mar 18.
19	Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
20	Aspirin-mediated COX-2 transcript stabilization via sustained p38 activation in human intestinal myofibroblasts. Mol Pharmacol. 2004 Feb;65(2):470-8.
21	Redox imbalance induced by contact sensitizers triggers the maturation of dendritic cells. J Invest Dermatol. 2005 Mar;124(3):579-86. doi: 10.1111/j.0022-202X.2005.23624.x.
22	The effects of dasatinib on IgE receptor-dependent activation and histamine release in human basophils. Blood. 2008 Mar 15;111(6):3097-107.
23	Antimyeloma activity of two novel N-substituted and tetraflourinated thalidomide analogs. Leukemia. 2005 Jul;19(7):1253-61. doi: 10.1038/sj.leu.2403776.
24	Cytotoxic synergy between the multikinase inhibitor sorafenib and the proteasome inhibitor bortezomib in vitro: induction of apoptosis through Akt and c-Jun NH2-terminal kinase pathways. Mol Cancer Ther. 2006 Sep;5(9):2378-87. doi: 10.1158/1535-7163.MCT-06-0235.
25	Characterization of cell death induced by ethacrynic acid in a human colon cancer cell line DLD-1 and suppression by N-acetyl-L-cysteine. Cancer Sci. 2003 Oct;94(10):886-93.
26	A novel UBA and UBX domain protein that binds polyubiquitin and VCP and is a substrate for SAPKs. Biochem J. 2004 Dec 1;384(Pt 2):391-400. doi: 10.1042/BJ20041498.
27	Desipramine-induced Ca-independent apoptosis in Mg63 human osteosarcoma cells: dependence on P38 mitogen-activated protein kinase-regulated activation of caspase 3. Clin Exp Pharmacol Physiol. 2009 Mar;36(3):297-303. doi: 10.1111/j.1440-1681.2008.05065.x. Epub 2008 Oct 15.
28	Molecular mechanisms of resveratrol action in lung cancer cells using dual protein and microarray analyses. Cancer Res. 2007 Dec 15;67(24):12007-17. doi: 10.1158/0008-5472.CAN-07-2464.
29	Application of the adverse outcome pathway concept for investigating developmental neurotoxicity potential of Chinese herbal medicines by using human neural progenitor cells in vitro. Cell Biol Toxicol. 2023 Feb;39(1):319-343. doi: 10.1007/s10565-022-09730-4. Epub 2022 Jun 15.
30	N-(4-hydroxyphenyl)retinamide-induced apoptosis triggered by reactive oxygen species is mediated by activation of MAPKs in head and neck squamous carcinoma cells. Oncogene. 2006 May 4;25(19):2785-94. doi: 10.1038/sj.onc.1209303.
31	Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
32	Phosphorylation of initiation factor 4E is resistant to SB203580 in cells expressing a drug-resistant mutant of stress-activated protein kinase 2a/p38. Cell Signal. 2003 Aug;15(8):741-9. doi: 10.1016/s0898-6568(03)00008-1.
33	Inhibition of CXCL12-mediated chemotaxis of Jurkat cells by direct immunotoxicants. Arch Toxicol. 2016 Jul;90(7):1685-94. doi: 10.1007/s00204-015-1585-7. Epub 2015 Aug 28.
34	Induction of apoptosis in human leukemia cells by the tyrosine kinase inhibitor adaphostin proceeds through a RAF-1/MEK/ERK- and AKT-dependent process. Oncogene. 2004 Feb 19;23(7):1364-76. doi: 10.1038/sj.onc.1207248.
35	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
36	PKC delta-induced activation of MAPK pathway is required for bFGF-stimulated proliferation of coronary smooth muscle cells. Cardiovasc Res. 2005 Jul 1;67(1):142-50. doi: 10.1016/j.cardiores.2005.03.009. Epub 2005 Apr 12.
37	Differential effect of p38 and MK2 kinase inhibitors on the inflammatory and toxicity biomarkers in vitro. Hum Exp Toxicol. 2018 May;37(5):521-531. doi: 10.1177/0960327117715901. Epub 2017 Jun 20.
38	Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
39	A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
40	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
41	Capsaicin attenuates palmitate-induced expression of macrophage inflammatory protein 1 and interleukin 8 by increasing palmitate oxidation and reducing c-Jun activation in THP-1 (human acute monocytic leukemia cell) cells. Nutr Res. 2011 Jun;31(6):468-78. doi: 10.1016/j.nutres.2011.05.007. Epub 2011 Jun 17.
42	Protein kinase C-ERK1/2 signal pathway switches glucose depletion-induced necrosis to apoptosis by regulating superoxide dismutases and suppressing reactive oxygen species production in A549 lung cancer cells. J Cell Physiol. 2007 May;211(2):371-85. doi: 10.1002/jcp.20941.
43	Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
44	Signaling pathways mediating manganese-induced toxicity in human glioblastoma cells (u87). Neurochem Res. 2006 Oct;31(10):1211-8. doi: 10.1007/s11064-006-9178-8. Epub 2006 Oct 17.
45	Transcriptomic profile indicative of immunotoxic exposure: in vitro studies in peripheral blood mononuclear cells. Toxicol Sci. 2010 Nov;118(1):19-30.
46	Acrolein induces activation of the epidermal growth factor receptor of human keratinocytes for cell death. J Cell Biochem. 2001;81(4):679-88. doi: 10.1002/jcb.1105.
47	Specificity and mechanism of action of some commonly used protein kinase inhibitors. Biochem J. 2000 Oct 1;351(Pt 1):95-105.
48	SZC015, a synthetic oleanolic acid derivative, induces both apoptosis and autophagy in MCF-7 breast cancer cells. Chem Biol Interact. 2016 Jan 25;244:94-104. doi: 10.1016/j.cbi.2015.11.013. Epub 2015 Nov 21.
49	Syringic acid regulates suppression of the STAT3/JNK/AKT pathway via inhibition of human ovarian teratoma cancer cell?(PA-1) growth-in vitro study. J Biochem Mol Toxicol. 2021 Jun;35(6):1-9. doi: 10.1002/jbt.22776. Epub 2021 Mar 23.
50	Oxyresveratrol improves tight junction integrity through the PKC and MAPK signaling pathways in Caco-2?cells. Food Chem Toxicol. 2017 Oct;108(Pt A):203-213. doi: 10.1016/j.fct.2017.08.002. Epub 2017 Aug 2.
51	Apoptosis induced by crocidolite asbestos in human lung epithelial cells involves inactivation of Akt and MAPK pathways. Apoptosis. 2007 Feb;12(2):433-47. doi: 10.1007/s10495-006-0577-8.
52	Inhibition of p38alpha MAPK enhances proteasome inhibitor-induced apoptosis of myeloma cells by modulating Hsp27, Bcl-X(L), Mcl-1 and p53 levels in vitro and inhibits tumor growth in vivo. Leukemia. 2006 Jun;20(6):1017-27. doi: 10.1038/sj.leu.2404200.
53	ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
54	Novel action of activin and bone morphogenetic protein in regulating aldosterone production by human adrenocortical cells. Endocrinology. 2004 Feb;145(2):639-49. doi: 10.1210/en.2003-0968. Epub 2003 Oct 30.
55	High-throughput ectopic expression screen for tamoxifen resistance identifies an atypical kinase that blocks autophagy. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2058-63.