Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5Z27TW)

DOT Name Lymphokine-activated killer T-cell-originated protein kinase (PBK)
Synonyms EC 2.7.12.2; Cancer/testis antigen 84; CT84; MAPKK-like protein kinase; Nori-3; PDZ-binding kinase; Spermatogenesis-related protein kinase; SPK; T-LAK cell-originated protein kinase
Gene Name PBK
UniProt ID
TOPK_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5J0A
EC Number
2.7.12.2
Pfam ID
PF00069
Sequence
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSP
WAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGE
KSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEM
MTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVC
TNEDPKDRPSAAHIVEALETDV
Function
Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.
Tissue Specificity Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Etoposide DMNH3PG Approved Lymphokine-activated killer T-cell-originated protein kinase (PBK) affects the response to substance of Etoposide. [41]
Mitomycin DMH0ZJE Approved Lymphokine-activated killer T-cell-originated protein kinase (PBK) affects the response to substance of Mitomycin. [41]
------------------------------------------------------------------------------------
40 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [2]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [8]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [9]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [10]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [10]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [11]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [12]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [14]
Progesterone DMUY35B Approved Progesterone decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [15]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [16]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [17]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [18]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [19]
Lucanthone DMZLBUO Approved Lucanthone decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [20]
Methamphetamine DMPM4SK Approved Methamphetamine decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [21]
Palbociclib DMD7L94 Approved Palbociclib decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [22]
Bicalutamide DMZMSPF Approved Bicalutamide decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [23]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [24]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [25]
GSK2110183 DMZHB37 Phase 2 GSK2110183 decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [26]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [27]
PEITC DMOMN31 Phase 2 PEITC decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [28]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [29]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [30]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [31]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [32]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [34]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [35]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [36]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [37]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [38]
KOJIC ACID DMP84CS Investigative KOJIC ACID decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [39]
Dibutyl phthalate DMEDGKO Investigative Dibutyl phthalate decreases the expression of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [40]
------------------------------------------------------------------------------------
⏷ Show the Full List of 40 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Marinol DM70IK5 Approved Marinol decreases the methylation of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [13]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [33]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Lymphokine-activated killer T-cell-originated protein kinase (PBK). [33]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5 RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
10 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
11 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
12 Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
13 Epigenetic activation of O-linked -N-acetylglucosamine transferase overrides the differentiation blockage in acute leukemia. EBioMedicine. 2020 Apr;54:102678. doi: 10.1016/j.ebiom.2020.102678. Epub 2020 Apr 6.
14 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
15 Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
16 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
17 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
18 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
19 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
20 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
21 Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
22 Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
23 Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
24 Resveratrol-induced gene expression profiles in human prostate cancer cells. Cancer Epidemiol Biomarkers Prev. 2005 Mar;14(3):596-604. doi: 10.1158/1055-9965.EPI-04-0398.
25 Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
26 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
27 Comparison of gene expression profiles in HepG2 cells exposed to arsenic, cadmium, nickel, and three model carcinogens for investigating the mechanisms of metal carcinogenesis. Environ Mol Mutagen. 2009 Jan;50(1):46-59.
28 Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
29 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
30 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
31 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
32 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
33 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
34 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
35 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
36 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
37 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
38 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
39 Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
40 In Vitro Exposure of Human Luteinized Mural Granulosa Cells to Dibutyl Phthalate Affects Global Gene Expression. Toxicol Sci. 2017 Nov 1;160(1):180-188. doi: 10.1093/toxsci/kfx170.
41 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.