Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6IFS0O)

• DOT Name: Ferritin heavy chain (FTH1)
• Synonyms: Ferritin H subunit; EC 1.16.3.1; Cell proliferation-inducing gene 15 protein
• Gene Name: FTH1
• Related Disease: Hemochromatosis type 5
• UniProt ID: FRIH_HUMAN
• PDB ID: 1FHA ; 2CEI ; 2CHI ; 2CIH ; 2CLU ; 2CN6 ; 2CN7 ; 2FHA ; 2IU2 ; 2Z6M ; 3AJO ; 3AJP ; 3AJQ ; 3ERZ ; 3ES3 ; 4DYX ; 4DYY ; 4DYZ ; 4DZ0 ; 4OYN ; 4Y08 ; 4YKH ; 4ZJK ; 5CMQ ; 5CMR ; 5GN8 ; 5GOU ; 5JKK ; 5JKL ; 5JKM ; 5N26 ; 5N27 ; 5UP7 ; 5UP8 ; 5UP9 ; 5VTD ; 5XB1 ; 5YI5 ; 5ZND ; 6B8F ; 6B8G ; 6FTV ; 6GSR ; 6H5I ; 6H6T ; 6H6U ; 6IPC ; 6IPO ; 6IPP ; 6IPQ ; 6J4A ; 6J7G ; 6JOB ; 6JPS ; 6KE2 ; 6KE4 ; 6M52 ; 6M54 ; 6WYF ; 6WYG ; 6WYH ; 6Z6U ; 6Z9E ; 6Z9F ; 7A6A ; 7A6B ; 7CK8 ; 7CK9 ; 7JGK ; 7JGL ; 7JGM ; 7JGN ; 7JGO ; 7JGP ; 7JGQ ; 7K26 ; 7K3V ; 7K3W ; 7KE3 ; 7KE5 ; 7PF1 ; 7R5O ; 7RRP ; 7V66 ; 7VD8 ; 7ZG7 ; 8A2L ; 8A2M ; 8A5N ; 8B7O ; 8CPM ; 8CPS ; 8CPT ; 8CPU ; 8CPV ; 8CPW ; 8CPX ; 8DHX ; 8DNP ; 8F49 ; 8HHS
• EC Number: 1.16.3.1
• Pfam ID: PF00210
• Sequence:
  MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
  HEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHK
  LATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSD
  NES
• Function: Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.
• Tissue Specificity: Expressed in the liver.
• KEGG Pathway:
  Porphyrin metabolism (hsa00860)
  Ferroptosis (hsa04216)
  Necroptosis (hsa04217)
  Mineral absorption (hsa04978)
• Reactome Pathway:
  Golgi Associated Vesicle Biogenesis (R-HSA-432722)
  Neutrophil degranulation (R-HSA-6798695)
  Iron uptake and transport (R-HSA-917937)
  Scavenging by Class A Receptors (R-HSA-3000480)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hemochromatosis type 5	DISAUGYR	Moderate	Autosomal dominant	[1]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Ferritin heavy chain (FTH1) decreases the response to substance of Paclitaxel.	[45]
Topotecan	DMP6G8T	Approved	Ferritin heavy chain (FTH1) affects the response to substance of Topotecan.	[46]

52 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ferritin heavy chain (FTH1).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Ferritin heavy chain (FTH1).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Ferritin heavy chain (FTH1).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Ferritin heavy chain (FTH1).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Ferritin heavy chain (FTH1).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Ferritin heavy chain (FTH1).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Ferritin heavy chain (FTH1).	[8]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Ferritin heavy chain (FTH1).	[9]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Ferritin heavy chain (FTH1).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Ferritin heavy chain (FTH1).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Ferritin heavy chain (FTH1).	[12]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Ferritin heavy chain (FTH1).	[13]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Ferritin heavy chain (FTH1).	[14]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Ferritin heavy chain (FTH1).	[15]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Ferritin heavy chain (FTH1).	[16]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Ferritin heavy chain (FTH1).	[17]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Ferritin heavy chain (FTH1).	[18]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Ferritin heavy chain (FTH1).	[19]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Ferritin heavy chain (FTH1).	[20]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Ferritin heavy chain (FTH1).	[21]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Ferritin heavy chain (FTH1).	[16]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of Ferritin heavy chain (FTH1).	[22]
Artesunate	DMR27C8	Approved	Artesunate decreases the expression of Ferritin heavy chain (FTH1).	[23]
Gamolenic acid	DMQN30Z	Approved	Gamolenic acid increases the expression of Ferritin heavy chain (FTH1).	[24]
Nicotinamide	DMUPE07	Approved	Nicotinamide increases the expression of Ferritin heavy chain (FTH1).	[25]
Tecfidera	DM2OVDT	Approved	Tecfidera increases the expression of Ferritin heavy chain (FTH1).	[26]
Pentaerythritol tetranitrate	DMZ9MO5	Approved	Pentaerythritol tetranitrate increases the expression of Ferritin heavy chain (FTH1).	[27]
Isoflavone	DM7U58J	Phase 4	Isoflavone increases the expression of Ferritin heavy chain (FTH1).	[28]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Ferritin heavy chain (FTH1).	[29]
Chloroquine	DMSI5CB	Phase 3 Trial	Chloroquine increases the expression of Ferritin heavy chain (FTH1).	[23]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Ferritin heavy chain (FTH1).	[30]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Ferritin heavy chain (FTH1).	[32]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Ferritin heavy chain (FTH1).	[33]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Ferritin heavy chain (FTH1).	[34]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Ferritin heavy chain (FTH1).	[35]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of Ferritin heavy chain (FTH1).	[20]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Ferritin heavy chain (FTH1).	[36]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Ferritin heavy chain (FTH1).	[37]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the expression of Ferritin heavy chain (FTH1).	[38]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Ferritin heavy chain (FTH1).	[39]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID increases the expression of Ferritin heavy chain (FTH1).	[25]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone decreases the expression of Ferritin heavy chain (FTH1).	[40]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of Ferritin heavy chain (FTH1).	[41]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Ferritin heavy chain (FTH1).	[42]
acrolein	DMAMCSR	Investigative	acrolein increases the expression of Ferritin heavy chain (FTH1).	[35]
Rutin	DMEHRAJ	Investigative	Rutin decreases the expression of Ferritin heavy chain (FTH1).	[43]
CATECHIN	DMY38SB	Investigative	CATECHIN increases the expression of Ferritin heavy chain (FTH1).	[43]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol increases the expression of Ferritin heavy chain (FTH1).	[29]
1,6-hexamethylene diisocyanate	DMLB3RT	Investigative	1,6-hexamethylene diisocyanate increases the expression of Ferritin heavy chain (FTH1).	[35]
Protoporphyrin IX	DMWYE7A	Investigative	Protoporphyrin IX increases the expression of Ferritin heavy chain (FTH1).	[44]
NSC-1771	DMNXDGQ	Investigative	NSC-1771 increases the expression of Ferritin heavy chain (FTH1).	[35]
Citraconic acid	DMCIM9A	Investigative	Citraconic acid increases the expression of Ferritin heavy chain (FTH1).	[26]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Ferritin heavy chain (FTH1).	[31]

References

• [1] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Identification of estrogen-induced genes downregulated by AhR agonists in MCF-7 breast cancer cells using suppression subtractive hybridization. Gene. 2001 Jan 10;262(1-2):207-14. doi: 10.1016/s0378-1119(00)00530-8.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [10] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [11] [Construction of subtracted cDNA library in human Jurkat T cell line induced by arsenic trioxide in vitro]. Zhonghua Yu Fang Yi Xue Za Zhi. 2003 Nov;37(6):403-7.
• [12] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [13] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [14] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [15] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [16] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [17] Cannabidiol induces antioxidant pathways in keratinocytes by targeting BACH1. Redox Biol. 2020 Jan;28:101321. doi: 10.1016/j.redox.2019.101321. Epub 2019 Sep 5.
• [18] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [19] Survival of retinal pigment epithelium after exposure to prolonged oxidative injury: a detailed gene expression and cellular analysis. Invest Ophthalmol Vis Sci. 2004 Oct;45(10):3767-77.
• [20] Silibinin inhibits ethanol- or acetaldehyde-induced ferroptosis in liver cell lines. Toxicol In Vitro. 2022 Aug;82:105388. doi: 10.1016/j.tiv.2022.105388. Epub 2022 May 18.
• [21] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [22] Growth-suppressive effect of non-steroidal anti-inflammatory drugs on 11 colon-cancer cell lines and fluorescence differential display of genes whose expression is influenced by sulindac. Int J Cancer. 2000 Dec 15;88(6):873-80. doi: 10.1002/1097-0215(20001215)88:6<873::aid-ijc6>3.0.co;2-b.
• [23] Artesunate alleviates liver fibrosis by regulating ferroptosis signaling pathway. Biomed Pharmacother. 2019 Jan;109:2043-2053. doi: 10.1016/j.biopha.2018.11.030. Epub 2018 Nov 26.
• [24] Antineoplastic effects of gamma linolenic Acid on hepatocellular carcinoma cell lines. J Clin Biochem Nutr. 2010 Jul;47(1):81-90.
• [25] Examining the impact of skin lighteners in vitro. Oxid Med Cell Longev. 2013;2013:702120. doi: 10.1155/2013/702120. Epub 2013 Apr 28.
• [26] Fumarate Mediates a Chronic Proliferative Signal in Fumarate Hydratase-Inactivated Cancer Cells by Increasing Transcription and Translation of Ferritin Genes. Mol Cell Biol. 2017 May 16;37(11):e00079-17. doi: 10.1128/MCB.00079-17. Print 2017 Jun 1.
• [27] Pentaerythrityl tetranitrate and nitroglycerin, but not isosorbide mononitrate, prevent endothelial dysfunction induced by ischemia and reperfusion. Arterioscler Thromb Vasc Biol. 2007 Sep;27(9):1955-9. doi: 10.1161/ATVBAHA.107.149278. Epub 2007 Jul 19.
• [28] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [29] Role of AMP-activated protein kinase in ferritin H gene expression by resveratrol in human T cells. Biochemistry. 2013 Jul 30;52(30):5075-83. doi: 10.1021/bi400399f. Epub 2013 Jul 16.
• [30] MIP-1beta, a novel biomarker for in vitro sensitization test using human monocytic cell line. Toxicol In Vitro. 2006 Aug;20(5):736-42.
• [31] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [32] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [33] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [34] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [35] Gene expressions changes in bronchial epithelial cells: markers for respiratory sensitizers and exploration of the NRF2 pathway. Toxicol In Vitro. 2014 Mar;28(2):209-17.
• [36] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [37] Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.
• [38] Impaired ferritinophagy flux induced by high fat diet mediates hepatic insulin resistance via endoplasmic reticulum stress. Food Chem Toxicol. 2020 Jun;140:111329. doi: 10.1016/j.fct.2020.111329. Epub 2020 Apr 10.
• [39] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [40] Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
• [41] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.
• [42] Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.
• [43] Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.
• [44] The interaction of Hemin and Sestrin2 modulates oxidative stress and colon tumor growth. Toxicol Appl Pharmacol. 2019 Jul 1;374:77-85.
• [45] cDNA microarray analysis of isogenic paclitaxel- and doxorubicin-resistant breast tumor cell lines reveals distinct drug-specific genetic signatures of resistance. Breast Cancer Res Treat. 2006 Mar;96(1):17-39. doi: 10.1007/s10549-005-9026-6. Epub 2005 Dec 2.
• [46] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.