Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT71OI2Y)

• DOT Name: Laminin subunit beta-2 (LAMB2)
• Synonyms: Laminin B1s chain; Laminin-11 subunit beta; Laminin-14 subunit beta; Laminin-15 subunit beta; Laminin-3 subunit beta; Laminin-4 subunit beta; Laminin-7 subunit beta; Laminin-9 subunit beta; S-laminin subunit beta; S-LAM beta
• Gene Name: LAMB2
• Related Disease:
  Cognitive impairment
  Nephropathy
  Pierson syndrome
  Attention deficit hyperactivity disorder
  Brain neoplasm
  Diabetic kidney disease
  Familial nephrotic syndrome
  Focal segmental glomerulosclerosis
  Galloway-Mowat syndrome
  Hypopituitarism
  Kidney failure
  LAMB2-related infantile-onset nephrotic syndrome
  Melanoma
  Nephrotic syndrome
  Pathologic nystagmus
  Prostate cancer
  Prostate neoplasm
  Steroid-resistant nephrotic syndrome
  Autosomal dominant medullary cystic kidney disease with or without hyperuricemia
  Retinopathy
  Glioma
  Intellectual disability
  Congenital myasthenic syndrome
  Muscular dystrophy
  Parkinson disease
  Van der Woude syndrome
  Wilms tumor
• UniProt ID: LAMB2_HUMAN
• Pfam ID: PF00053 ; PF21199 ; PF00055
• Sequence:
  MELTSRERGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
  RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
  AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
  DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL
  KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
  HAEGMVHGACICKHNTRGLNCEQCQDFYRDLPWRPAEDGHSHACRKCECHGHTHSCHFDM
  AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
  GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDRLGCRRCQCNARGTVPG
  STPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEGTGQ
  CHCRQHMVGRRCEQVQPGYFRPFLDHLIWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV
  RLQEGQTLEFLVASVPKAMDYDLLLRLEPQVPEQWAELELIVQRPGPVPAHSLCGHLVPK
  DDRIQGTLQPHARYLIFPNPVCLEPGISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVL
  LPRVLVLEMFSGGDAAALERQATFERYQCHEEGLVPSKTSPSEACAPLLISLSTLIYNGA
  LPCQCNPQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSHEGALS
  SLCEKTSGQCLCRTGAFGLRCDRCQRGQWGFPSCRPCVCNGHADECNTHTGACLGCRDHT
  GGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHQDEYSQQIVCHCRAGY
  TGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHHTEGPHCA
  HCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDPSSGQCPCLPNVQGPSCDRCA
  PNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPGLQC
  HACDCDSRGIDTPQCHRFTGHCSCRPGVSGVRCDQCARGFSGIFPACHPCHACFGDWDRV
  VQDLAARTQRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVE
  ATEELRREIGEATEHLTQLEADLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDL
  LKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFN
  SKHMANQRALGKLSAHTHTLSLTDINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL
  SCNGAAATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA
  SRGQVEQANQELQELIQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA
  ERVRSLADVDAILARTVGDVRRAEQLLQDARRARSWAEDEKQKAETVQAALEEAQRAQGI
  AQGAIRGAVADTRDTEQTLYQVQERMAGAERALSSAGERARQLDALLEALKLKRAGNSLA
  ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDEARD
  LLQAAQDKLQRLQELEGTYEENERALESKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
• Function: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
• KEGG Pathway:
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Toxoplasmosis (hsa05145)
  Amoebiasis (hsa05146)
  Human papillomavirus infection (hsa05165)
  Pathways in cancer (hsa05200)
  Small cell lung cancer (hsa05222)
• Reactome Pathway:
  Non-integrin membrane-ECM interactions (R-HSA-3000171)
  ECM proteoglycans (R-HSA-3000178)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  MET activates PTK2 signaling (R-HSA-8874081)
  Post-translational protein phosphorylation (R-HSA-8957275)
  Laminin interactions (R-HSA-3000157)

Molecular Interaction Atlas (MIA) of This DOT

27 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cognitive impairment	DISH2ERD	Definitive	Biomarker	[1]
Nephropathy	DISXWP4P	Definitive	Genetic Variation	[2]
Pierson syndrome	DIS0DF3C	Definitive	Autosomal recessive	[3]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[4]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[5]
Diabetic kidney disease	DISJMWEY	Strong	Altered Expression	[6]
Familial nephrotic syndrome	DISADF8G	Strong	Genetic Variation	[7]
Focal segmental glomerulosclerosis	DISJNHH0	Strong	Genetic Variation	[8]
Galloway-Mowat syndrome	DISVB7IM	Strong	Biomarker	[9]
Hypopituitarism	DIS1QT3G	Strong	Genetic Variation	[7]
Kidney failure	DISOVQ9P	Strong	Genetic Variation	[10]
LAMB2-related infantile-onset nephrotic syndrome	DISPHEAV	Strong	Autosomal recessive	[11]
Melanoma	DIS1RRCY	Strong	Biomarker	[12]
Nephrotic syndrome	DISSPSC2	Strong	Genetic Variation	[13]
Pathologic nystagmus	DIS1QSPO	Strong	Genetic Variation	[14]
Prostate cancer	DISF190Y	Strong	Biomarker	[15]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[15]
Steroid-resistant nephrotic syndrome	DISVEBC9	Strong	Biomarker	[16]
Autosomal dominant medullary cystic kidney disease with or without hyperuricemia	DIS3PLLZ	moderate	Biomarker	[17]
Retinopathy	DISB4B0F	moderate	Genetic Variation	[18]
Glioma	DIS5RPEH	Disputed	Biomarker	[19]
Intellectual disability	DISMBNXP	Disputed	Genetic Variation	[20]
Congenital myasthenic syndrome	DISJLG2T	Limited	Biomarker	[21]
Muscular dystrophy	DISJD6P7	Limited	Biomarker	[22]
Parkinson disease	DISQVHKL	Limited	Biomarker	[23]
Van der Woude syndrome	DISADZS1	Limited	Biomarker	[24]
Wilms tumor	DISB6T16	Limited	Biomarker	[25]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Laminin subunit beta-2 (LAMB2).	[26]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Laminin subunit beta-2 (LAMB2).	[27]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Laminin subunit beta-2 (LAMB2).	[28]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Laminin subunit beta-2 (LAMB2).	[29]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Laminin subunit beta-2 (LAMB2).	[30]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Laminin subunit beta-2 (LAMB2).	[32]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Laminin subunit beta-2 (LAMB2).	[33]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Laminin subunit beta-2 (LAMB2).	[34]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Laminin subunit beta-2 (LAMB2).	[34]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Laminin subunit beta-2 (LAMB2).	[35]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone affects the expression of Laminin subunit beta-2 (LAMB2).	[36]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Laminin subunit beta-2 (LAMB2).	[37]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Laminin subunit beta-2 (LAMB2).	[38]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Laminin subunit beta-2 (LAMB2).	[40]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Laminin subunit beta-2 (LAMB2).	[41]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Laminin subunit beta-2 (LAMB2).	[42]
Rutin	DMEHRAJ	Investigative	Rutin increases the expression of Laminin subunit beta-2 (LAMB2).	[32]
Chrysin	DM7V2LG	Investigative	Chrysin increases the expression of Laminin subunit beta-2 (LAMB2).	[32]
Kaempferol	DMHEMUB	Investigative	Kaempferol increases the expression of Laminin subunit beta-2 (LAMB2).	[32]
Apigenin	DMI3491	Investigative	Apigenin increases the expression of Laminin subunit beta-2 (LAMB2).	[32]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic increases the ubiquitination of Laminin subunit beta-2 (LAMB2).	[31]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Laminin subunit beta-2 (LAMB2).	[39]

References

• [1] Residential Proximity to Major Roadways at Birth, DNA Methylation at Birth and Midchildhood, and Childhood Cognitive Test Scores: Project Viva(Massachusetts, USA).Environ Health Perspect. 2018 Sep;126(9):97006. doi: 10.1289/EHP2034.
• [2] A syndrome comprising childhood-onset glomerular kidney disease and ocular abnormalities with progressive loss of vision is caused by mutated LAMB2.Nephrol Dial Transplant. 2006 Nov;21(11):3283-6. doi: 10.1093/ndt/gfl463. Epub 2006 Aug 18.
• [3] A Novel Homozygous Truncating Mutation in LAMB2 Gene in a Chinese Uyghur Patient With Severe Phenotype Pierson Syndrome. Front Med (Lausanne). 2019 Feb 4;6:12. doi: 10.3389/fmed.2019.00012. eCollection 2019.
• [4] Pediatric bipolar disorder and ADHD: family history comparison in the LAMS clinical sample.J Affect Disord. 2012 Dec 10;141(2-3):382-9. doi: 10.1016/j.jad.2012.03.015. Epub 2012 Mar 31.
• [5] Changes in laminin isoforms associated with brain tumor invasion and angiogenesis.Front Biosci. 2006 Jan 1;11:81-8. doi: 10.2741/1781.
• [6] RNA-binding protein IGF2BP2/IMP2 is required for laminin-2 mRNA translation and is modulated by glucose concentration.Am J Physiol Renal Physiol. 2012 Jul 1;303(1):F75-82. doi: 10.1152/ajprenal.00185.2012. Epub 2012 Apr 18.
• [7] Mutations in LAMB2 Are Associated With Albuminuria and Optic Nerve Hypoplasia With Hypopituitarism.J Clin Endocrinol Metab. 2020 Mar 1;105(3):595-9. doi: 10.1210/clinem/dgz216.
• [8] Retrospective mutational analysis of NPHS1, NPHS2, WT1 and LAMB2 in children with steroid-resistant focal segmental glomerulosclerosis - a single-centre experience.Bosn J Basic Med Sci. 2014 May;14(2):89-93. doi: 10.17305/bjbms.2014.2270.
• [9] Analysis of genes encoding laminin beta2 and related proteins in patients with Galloway-Mowat syndrome.Pediatr Nephrol. 2008 Oct;23(10):1779-86. doi: 10.1007/s00467-008-0880-4. Epub 2008 Jul 2.
• [10] Pathogenicity of a Human Laminin 2 Mutation Revealed in Models of Alport Syndrome.J Am Soc Nephrol. 2018 Mar;29(3):949-960. doi: 10.1681/ASN.2017090997. Epub 2017 Dec 20.
• [11] Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
• [12] Melanoma cells produce multiple laminin isoforms and strongly migrate on 5 laminin(s) via several integrin receptors.Exp Cell Res. 2011 May 1;317(8):1119-33. doi: 10.1016/j.yexcr.2010.12.019. Epub 2010 Dec 31.
• [13] A novel mutation of laminin 2 (LAMB2) in two siblings with renal failure.Eur J Pediatr. 2017 Apr;176(4):515-519. doi: 10.1007/s00431-017-2871-6. Epub 2017 Feb 10.
• [14] The first Chinese Pierson syndrome with novel mutations in LAMB2.Nephrol Dial Transplant. 2010 Mar;25(3):776-8. doi: 10.1093/ndt/gfp563. Epub 2009 Oct 26.
• [15] Identification of genes potentially involved in the acquisition of androgen-independent and metastatic tumor growth in an autochthonous genetically engineered mouse prostate cancer model.Prostate. 2007 Jan 1;67(1):83-106. doi: 10.1002/pros.20505.
• [16] LAMB2 mutation with different phenotypes in China?"Zhang H. Wang F
• [17] Endoplasmic reticulum stress and monogenic kidney diseases in precision nephrology.Pediatr Nephrol. 2019 Sep;34(9):1493-1500. doi: 10.1007/s00467-018-4031-2. Epub 2018 Aug 11.
• [18] A novel mutation of LAMB2 in a multigenerational mennonite family reveals a new phenotypic variant of Pierson syndrome.Ophthalmology. 2011 Jun;118(6):1137-44. doi: 10.1016/j.ophtha.2010.10.009. Epub 2011 Jan 13.
• [19] Laminin isoforms and their integrin receptors in glioma cell migration and invasiveness: Evidence for a role of alpha5-laminin(s) and alpha3beta1 integrin.Exp Cell Res. 2007 Nov 1;313(18):3819-31. doi: 10.1016/j.yexcr.2007.07.038. Epub 2007 Aug 16.
• [20] Mutations in PLCE1 are a major cause of isolated diffuse mesangial sclerosis (IDMS).Nephrol Dial Transplant. 2008 Apr;23(4):1291-7. doi: 10.1093/ndt/gfm759. Epub 2007 Dec 8.
• [21] Congenital myasthenic syndromes: recent advances.Curr Opin Neurol. 2016 Oct;29(5):565-71. doi: 10.1097/WCO.0000000000000370.
• [22] Chimeric protein identification of dystrophic, Pierson and other laminin polymerization residues.Matrix Biol. 2018 Apr;67:32-46. doi: 10.1016/j.matbio.2018.01.012. Epub 2018 Mar 3.
• [23] Pilot study: peripheral biomarkers for diagnosing sporadic Parkinson's disease.J Neural Transm (Vienna). 2010 Dec;117(12):1387-93. doi: 10.1007/s00702-010-0509-1. Epub 2010 Nov 11.
• [24] Linkage of an autosomal dominant clefting syndrome (Van der Woude) to loci on chromosome Iq.Am J Hum Genet. 1990 Mar;46(3):486-91.
• [25] Cyclosporine A responsive congenital nephrotic syndrome with single heterozygous variants in NPHS1, NPHS2, and PLCE1.Pediatr Nephrol. 2018 Jul;33(7):1269-1272. doi: 10.1007/s00467-018-3961-z. Epub 2018 Apr 16.
• [26] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [27] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [28] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [29] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [30] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [31] Quantitative Assessment of Arsenite-Induced Perturbation of Ubiquitinated Proteome. Chem Res Toxicol. 2022 Sep 19;35(9):1589-1597. doi: 10.1021/acs.chemrestox.2c00197. Epub 2022 Aug 22.
• [32] Flavonoids suppress human glioblastoma cell growth by inhibiting cell metabolism, migration, and by regulating extracellular matrix proteins and metalloproteinases expression. Chem Biol Interact. 2015 Dec 5;242:123-38. doi: 10.1016/j.cbi.2015.07.014. Epub 2015 Sep 25.
• [33] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [34] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [35] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [36] Proteomic analysis of human adipose tissue after rosiglitazone treatment shows coordinated changes to promote glucose uptake. Obesity (Silver Spring). 2010 Jan;18(1):27-34. doi: 10.1038/oby.2009.208. Epub 2009 Jun 25.
• [37] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [38] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [39] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [40] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [41] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [42] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.