Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAE1UA1)

• DOT Name: Scavenger receptor class B member 1 (SCARB1)
• Synonyms: SRB1; CD36 and LIMPII analogous 1; CLA-1; CD36 antigen-like 1; Collagen type I receptor, thrombospondin receptor-like 1; SR-BI; CD antigen CD36
• Gene Name: SCARB1
• UniProt ID: SCRB1_HUMAN
• Pfam ID: PF01130
• Sequence:
  MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIP
  IPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQ
  FQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIM
  WGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGL
  SKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYR
  FVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTG
  LHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
  AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQVGAGQRAARADSH
  SLACWGKGASDRTLWPTAAWSPPPAAVLRLCRSGSGHCWGLRSTLASFACRVATTLPVLE
  GLGPSLGGGTGS
• Function: Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Receptor for HDL, mediating selective uptake of cholesteryl ether and HDL-dependent cholesterol efflux. Also facilitates the flux of free and esterified cholesterol between the cell surface and apoB-containing lipoproteins and modified lipoproteins, although less efficiently than HDL. May be involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity ; (Microbial infection) Acts as a receptor for hepatitis C virus in hepatocytes and appears to facilitate its cell entry. Binding between SCARB1 and the hepatitis C virus glycoprotein E2 is independent of the genotype of the viral isolate ; (Microbial infection) Mediates uptake of M.fortuitum, E.coli and S.aureus; (Microbial infection) Facilitates the entry of human coronavirus SARS-CoV-2 by acting as an entry cofactor through HDL binding.
• Tissue Specificity: Widely expressed.
• KEGG Pathway:
  Phagosome (hsa04145)
  Ovarian steroidogenesis (hsa04913)
  Aldosterone synthesis and secretion (hsa04925)
  Cortisol synthesis and secretion (hsa04927)
  Cushing syndrome (hsa04934)
  Fat digestion and absorption (hsa04975)
  Bile secretion (hsa04976)
  Vitamin digestion and absorption (hsa04977)
  Cholesterol metabolism (hsa04979)
  Hepatitis C (hsa05160)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Beta-carotene	DM0RXBT	Approved	Scavenger receptor class B member 1 (SCARB1) increases the transport of Beta-carotene.	[25]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Scavenger receptor class B member 1 (SCARB1).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Scavenger receptor class B member 1 (SCARB1).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Scavenger receptor class B member 1 (SCARB1).	[30]

33 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Scavenger receptor class B member 1 (SCARB1).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Scavenger receptor class B member 1 (SCARB1).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[10]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Scavenger receptor class B member 1 (SCARB1).	[11]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[12]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[13]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[14]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the splicing of Scavenger receptor class B member 1 (SCARB1).	[15]
Cocaine	DMSOX7I	Approved	Cocaine increases the expression of Scavenger receptor class B member 1 (SCARB1).	[16]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Scavenger receptor class B member 1 (SCARB1).	[17]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of Scavenger receptor class B member 1 (SCARB1).	[18]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Scavenger receptor class B member 1 (SCARB1).	[19]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[20]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Scavenger receptor class B member 1 (SCARB1).	[21]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[22]
Ritonavir	DMU764S	Approved	Ritonavir increases the expression of Scavenger receptor class B member 1 (SCARB1).	[23]
Chenodiol	DMQ8JIK	Approved	Chenodiol increases the expression of Scavenger receptor class B member 1 (SCARB1).	[24]
Deoxycholic acid	DM3GYAL	Approved	Deoxycholic acid increases the expression of Scavenger receptor class B member 1 (SCARB1).	[24]
Vitamin B3	DMQVRZH	Approved	Vitamin B3 increases the expression of Scavenger receptor class B member 1 (SCARB1).	[13]
Ezetimibe	DM7A8TW	Approved	Ezetimibe decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[25]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Scavenger receptor class B member 1 (SCARB1).	[26]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Scavenger receptor class B member 1 (SCARB1).	[27]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl affects the expression of Scavenger receptor class B member 1 (SCARB1).	[28]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[29]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[31]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[32]
	DM9CEI5		decreases the expression of Scavenger receptor class B member 1 (SCARB1).	[20]
T0901317	DMZQVDI	Investigative	T0901317 increases the expression of Scavenger receptor class B member 1 (SCARB1).	[21]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal affects the binding of Scavenger receptor class B member 1 (SCARB1).	[10]

References

• [1] Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [7] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [8] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Cigarette smoke affects keratinocytes SRB1 expression and localization via H2O2 production and HNE protein adducts formation. PLoS One. 2012;7(3):e33592. doi: 10.1371/journal.pone.0033592. Epub 2012 Mar 19.
• [11] Effects of rosiglitazone and atorvastatin on the expression of genes that control cholesterol homeostasis in differentiating monocytes. Biochem Pharmacol. 2006 Feb 28;71(5):605-14.
• [12] Prenatal ethanol exposure-induced a low level of foetal blood cholesterol and its mechanism of IGF1-related placental cholesterol transport dysfunction. Toxicology. 2019 Aug 1;424:152237. doi: 10.1016/j.tox.2019.152237. Epub 2019 Jun 18.
• [13] Stimulation of CD36 and the key effector of reverse cholesterol transport ATP-binding cassette A1 in monocytoid cells by niacin. Biochem Pharmacol. 2004 Feb 1;67(3):411-9. doi: 10.1016/j.bcp.2003.09.014.
• [14] Placental mechanism of prenatal nicotine exposure-reduced blood cholesterol levels in female fetal rats. Toxicol Lett. 2018 Oct 15;296:31-38. doi: 10.1016/j.toxlet.2018.07.022. Epub 2018 Jul 20.
• [15] Regulation of alternative splicing of liver scavenger receptor class B gene by estrogen and the involved regulatory splicing factors. Endocrinology. 2007 Nov;148(11):5295-304. doi: 10.1210/en.2007-0376. Epub 2007 Aug 2.
• [16] Transcriptional changes common to human cocaine, cannabis and phencyclidine abuse. PLoS One. 2006 Dec 27;1(1):e114. doi: 10.1371/journal.pone.0000114.
• [17] Induction of scavenger receptor class B type I is critical for simvastatin enhancement of high-density lipoprotein-induced anti-inflammatory actions in endothelial cells. J Immunol. 2008 Nov 15;181(10):7332-40. doi: 10.4049/jimmunol.181.10.7332.
• [18] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [19] Aspirin regulates expression and function of scavenger receptor-BI in macrophages: studies in primary human macrophages and in mice. FASEB J. 2006 Jul;20(9):1328-35. doi: 10.1096/fj.05-5368com.
• [20] Pregnane X receptor-agonists down-regulate hepatic ATP-binding cassette transporter A1 and scavenger receptor class B type I. Biochem Biophys Res Commun. 2005 Jun 17;331(4):1533-41. doi: 10.1016/j.bbrc.2005.04.071.
• [21] Liver X receptor and retinoic X receptor agonists modulate the expression of genes involved in lipid metabolism in human endothelial cells. Int J Mol Med. 2005 Oct;16(4):717-22.
• [22] Glucocorticoid programming mechanism for hypercholesterolemia in prenatal ethanol-exposed adult offspring rats. Toxicol Appl Pharmacol. 2019 Jul 15;375:46-56.
• [23] Estrogen prevents cholesteryl ester accumulation in macrophages induced by the HIV protease inhibitor ritonavir. J Cell Biochem. 2008 Apr 1;103(5):1598-606. doi: 10.1002/jcb.21546.
• [24] Farnesoid X receptor induces murine scavenger receptor Class B type I via intron binding. PLoS One. 2012;7(4):e35895. doi: 10.1371/journal.pone.0035895. Epub 2012 Apr 23.
• [25] Carotenoid transport is decreased and expression of the lipid transporters SR-BI, NPC1L1, and ABCA1 is downregulated in Caco-2 cells treated with ezetimibe. J Nutr. 2005 Oct;135(10):2305-12. doi: 10.1093/jn/135.10.2305.
• [26] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [27] Resveratrol mediates anti-atherogenic effects on cholesterol flux in human macrophages and endothelium via PPARgama and adenosine. Eur J Pharmacol. 2013 Jan 5;698(1-3):299-309.
• [28] Fluorescent tagging of endogenous Heme oxygenase-1 in human induced pluripotent stem cells for high content imaging of oxidative stress in various differentiated lineages. Arch Toxicol. 2021 Oct;95(10):3285-3302. doi: 10.1007/s00204-021-03127-8. Epub 2021 Sep 4.
• [29] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [30] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [31] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [32] Di-n-butyl phthalate promotes lipid accumulation via the miR200c-5p-ABCA1 pathway in THP-1 macrophages. Environ Pollut. 2020 Sep;264:114723. doi: 10.1016/j.envpol.2020.114723. Epub 2020 May 3.