Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDKMB2G)

• DOT Name: Pleckstrin homology-like domain family B member 2 (PHLDB2)
• Synonyms: Protein LL5-beta
• Gene Name: PHLDB2
• Related Disease:
  Atrial fibrillation
  Colorectal carcinoma
  Esophageal squamous cell carcinoma
  Graves disease
  Neoplasm
  Advanced cancer
  Colon cancer
  Colon carcinoma
  Familial atrial fibrillation
• UniProt ID: PHLB2_HUMAN
• Pfam ID: PF00169
• Sequence:
  MEEHSYIQKELDLQNGSLEEDSVVHSVENDSQNMMESLSPKKYSSSLRFKANGDYSGSYL
  TLSQPVPAKRSPSPLGTSVRSSPSLAKIQGSKQFSYDGTDKNIPMKPPTPLLNTTSSLSG
  YPLGRADFDHYTGRDSERALRLSEKPPYSKYSSRHKSHDNVYSLGGLEGRKASGSLLAMW
  NGSSLSDAGPPPISRSGAASMPSSPKQARKMSIQDSLALQPKLTRHKELASENINLRTRK
  YSSSSLSHMGAYSRSLPRLYRATENQLTPLSLPPRNSLGNSKRTKLGEKDLPHSVIDNDN
  YLNFSSLSSGALPYKTSASEGNPYVSSTLSVPASPRVARKMLLASTSSCASDDFDQASYV
  GTNPSHSLLAGESDRVFATRRNFSCGSVEFDEADLESLRQASGTPQPALRERKSSISSIS
  GRDDLMDYHRRQREERLREQEMERLERQRLETILSLCAEYTKPDSRLSTGTTVEDVQKIN
  KELEKLQLSDEESVFEEALMSPDTRYRCHRKDSLPDADLASCGSLSQSSASFFTPRSTRN
  DELLSDLTRTPPPPSSTFPKASSESSYLSILPKTPEGISEEQRSQELAAMEETRIVILNN
  LEELKQKIKDINDQMDESFRELDMECALLDGEQKSETTELMKEKEILDHLNRKIAELEKN
  IVGEKTKEKVKLDAEREKLERLQELYSEQKTQLDNCPESMREQLQQQLKRDADLLDVESK
  HFEDLEFQQLEHESRLDEEKENLTQQLLREVAEYQRNIVSRKEKISALKKQANHIVQQAQ
  REQDHFVKEKNNLIMMLQREKENLCNLEKKYSSLSGGKGFPVNPNTLKEGYISVNEINEP
  CGNSTNLSPSTQFPADADAVATEPATAVLASQPQSKEHFRSLEERKKQHKEGLYLSDTLP
  RKKTTSSISPHFSSATMGRSITPKAHLPLGQSNSCGSVLPPSLAAMAKDSESRRMLRGYN
  HQQMSEGHRQKSEFYNRTASESNVYLNSFHYPDHSYKDQAFDTLSLDSSDSMETSISACS
  PDNISSASTSNIARIEEMERLLKQAHAEKTRLLESREREMEAKKRALEEEKRRREILEKR
  LQEETSQRQKLIEKEVKIRERQRAQARPLTRYLPVRKEDFDLRSHVETAGHNIDTCYHVS
  ITEKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVIYFQAIEEVYYD
  HLKNANKSPNPLLTFSVKTHDRIYYMVAPSPEAMRIWMDVIVTGAEGYTHFLL
• Function: Seems to be involved in the assembly of the postsynaptic apparatus. May play a role in acetyl-choline receptor (AChR) aggregation in the postsynaptic membrane.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[1]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[2]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[3]
Graves disease	DISU4KOQ	Strong	Genetic Variation	[4]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[2]
Colon cancer	DISVC52G	moderate	Biomarker	[2]
Colon carcinoma	DISJYKUO	moderate	Biomarker	[2]
Familial atrial fibrillation	DISL4AGF	moderate	Biomarker	[1]

7 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[5]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[17]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[23]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[17]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[26]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[31]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[7]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[8]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[9]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[10]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[11]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[12]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[13]
Vorinostat	DMWMPD4	Approved	Vorinostat affects the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[14]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[15]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[16]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[18]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[19]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[20]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[21]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[22]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[24]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[25]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[27]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[28]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[29]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[30]
CH-223191	DMMJZYC	Investigative	CH-223191 increases the expression of Pleckstrin homology-like domain family B member 2 (PHLDB2).	[32]

References

• [1] Multi-ethnic genome-wide association study for atrial fibrillation.Nat Genet. 2018 Jun 11;50(9):1225-1233. doi: 10.1038/s41588-018-0133-9.
• [2] Oncogenic effect of PHLDB2 is associated with epithelial-mesenchymal transition and E-cadherin regulation in colorectal cancer.Cancer Cell Int. 2019 Jul 16;19:184. doi: 10.1186/s12935-019-0903-1. eCollection 2019.
• [3] Histone Demethylase LSD1 Inhibitors Prevent Cell Growth by Regulating Gene Expression in Esophageal Squamous Cell Carcinoma Cells.Ann Surg Oncol. 2016 Jan;23(1):312-20. doi: 10.1245/s10434-015-4488-1. Epub 2015 Mar 20.
• [4] Genetic determinants of antithyroid drug-induced agranulocytosis by human leukocyte antigen genotyping and genome-wide association study.Nat Commun. 2015 Jul 7;6:7633. doi: 10.1038/ncomms8633.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [7] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [8] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [9] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [10] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [11] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [12] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [13] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [14] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [15] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [16] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [17] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [18] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [19] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [20] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [21] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [22] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [23] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [24] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [25] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [26] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [27] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [28] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [29] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [30] Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.
• [31] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [32] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.