General Information of Drug Off-Target (DOT) (ID: OTETYX40)

DOT Name Proto-oncogene tyrosine-protein kinase Src (SRC)
Synonyms EC 2.7.10.2; Proto-oncogene c-Src; pp60c-src; p60-Src
Gene Name SRC
Related Disease
Thrombocytopenia 6 ( )
Colorectal cancer ( )
UniProt ID
SRC_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1A07 ; 1A08 ; 1A09 ; 1A1A ; 1A1B ; 1A1C ; 1A1E ; 1FMK ; 1HCS ; 1HCT ; 1KSW ; 1O41 ; 1O42 ; 1O43 ; 1O44 ; 1O45 ; 1O46 ; 1O47 ; 1O48 ; 1O49 ; 1O4A ; 1O4B ; 1O4C ; 1O4D ; 1O4E ; 1O4F ; 1O4G ; 1O4H ; 1O4I ; 1O4J ; 1O4K ; 1O4L ; 1O4M ; 1O4N ; 1O4O ; 1O4P ; 1O4Q ; 1O4R ; 1SHD ; 1Y57 ; 1YI6 ; 1YOJ ; 1YOL ; 1YOM ; 2BDF ; 2BDJ ; 2H8H ; 2SRC ; 3VRO ; 3ZMP ; 3ZMQ ; 4F59 ; 4F5A ; 4F5B ; 4HXJ ; 4K11 ; 4MXO ; 4MXX ; 4MXY ; 4MXZ ; 6ATE ; 6C4S ; 6E6E ; 6EHJ ; 7NG7 ; 7OTE ; 7T1U ; 7YQE ; 8HAQ
EC Number
2.7.10.2
Pfam ID
PF07714 ; PF00017 ; PF00018
Sequence
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Function
Non-receptor protein tyrosine kinase which is activated following engagement of many different classes of cellular receptors including immune response receptors, integrins and other adhesion receptors, receptor protein tyrosine kinases, G protein-coupled receptors as well as cytokine receptors. Participates in signaling pathways that control a diverse spectrum of biological activities including gene transcription, immune response, cell adhesion, cell cycle progression, apoptosis, migration, and transformation. Due to functional redundancy between members of the SRC kinase family, identification of the specific role of each SRC kinase is very difficult. SRC appears to be one of the primary kinases activated following engagement of receptors and plays a role in the activation of other protein tyrosine kinase (PTK) families. Receptor clustering or dimerization leads to recruitment of SRC to the receptor complexes where it phosphorylates the tyrosine residues within the receptor cytoplasmic domains. Plays an important role in the regulation of cytoskeletal organization through phosphorylation of specific substrates such as AFAP1. Phosphorylation of AFAP1 allows the SRC SH2 domain to bind AFAP1 and to localize to actin filaments. Cytoskeletal reorganization is also controlled through the phosphorylation of cortactin (CTTN) (Probable). When cells adhere via focal adhesions to the extracellular matrix, signals are transmitted by integrins into the cell resulting in tyrosine phosphorylation of a number of focal adhesion proteins, including PTK2/FAK1 and paxillin (PXN). In addition to phosphorylating focal adhesion proteins, SRC is also active at the sites of cell-cell contact adherens junctions and phosphorylates substrates such as beta-catenin (CTNNB1), delta-catenin (CTNND1), and plakoglobin (JUP). Another type of cell-cell junction, the gap junction, is also a target for SRC, which phosphorylates connexin-43 (GJA1). SRC is implicated in regulation of pre-mRNA-processing and phosphorylates RNA-binding proteins such as KHDRBS1 (Probable). Also plays a role in PDGF-mediated tyrosine phosphorylation of both STAT1 and STAT3, leading to increased DNA binding activity of these transcription factors. Involved in the RAS pathway through phosphorylation of RASA1 and RASGRF1. Plays a role in EGF-mediated calcium-activated chloride channel activation. Required for epidermal growth factor receptor (EGFR) internalization through phosphorylation of clathrin heavy chain (CLTC and CLTCL1) at 'Tyr-1477'. Involved in beta-arrestin (ARRB1 and ARRB2) desensitization through phosphorylation and activation of GRK2, leading to beta-arrestin phosphorylation and internalization. Has a critical role in the stimulation of the CDK20/MAPK3 mitogen-activated protein kinase cascade by epidermal growth factor (Probable). Might be involved not only in mediating the transduction of mitogenic signals at the level of the plasma membrane but also in controlling progression through the cell cycle via interaction with regulatory proteins in the nucleus. Plays an important role in osteoclastic bone resorption in conjunction with PTK2B/PYK2. Both the formation of a SRC-PTK2B/PYK2 complex and SRC kinase activity are necessary for this function. Recruited to activated integrins by PTK2B/PYK2, thereby phosphorylating CBL, which in turn induces the activation and recruitment of phosphatidylinositol 3-kinase to the cell membrane in a signaling pathway that is critical for osteoclast function. Promotes energy production in osteoclasts by activating mitochondrial cytochrome C oxidase. Phosphorylates DDR2 on tyrosine residues, thereby promoting its subsequent autophosphorylation. Phosphorylates RUNX3 and COX2 on tyrosine residues, TNK2 on 'Tyr-284' and CBL on 'Tyr-731'. Enhances RIGI-elicited antiviral signaling. Phosphorylates PDPK1 at 'Tyr-9', 'Tyr-373' and 'Tyr-376'. Phosphorylates BCAR1 at 'Tyr-128'. Phosphorylates CBLC at multiple tyrosine residues, phosphorylation at 'Tyr-341' activates CBLC E3 activity. Phosphorylates synaptic vesicle protein synaptophysin (SYP). Involved in anchorage-independent cell growth. Required for podosome formation. Mediates IL6 signaling by activating YAP1-NOTCH pathway to induce inflammation-induced epithelial regeneration. Phosphorylates OTUB1, promoting deubiquitination of RPTOR. Phosphorylates caspase CASP8 at 'Tyr-380' which negatively regulates CASP8 processing and activation, down-regulating CASP8 proapoptotic function ; [Isoform 1]: Non-receptor protein tyrosine kinase which phosphorylates synaptophysin with high affinity; [Isoform 2]: Non-receptor protein tyrosine kinase which shows higher basal kinase activity than isoform 1, possibly due to weakened intramolecular interactions which enhance autophosphorylation of Tyr-419 and subsequent activation. The SH3 domain shows reduced affinity with the linker sequence between the SH2 and kinase domains which may account for the increased basal activity. Displays altered substrate specificity compared to isoform 1, showing weak affinity for synaptophysin and for peptide substrates containing class I or class II SH3 domain-binding motifs. Plays a role in L1CAM-mediated neurite elongation, possibly by acting downstream of L1CAM to drive cytoskeletal rearrangements involved in neurite outgrowth; [Isoform 3]: Non-receptor protein tyrosine kinase which shows higher basal kinase activity than isoform 1, possibly due to weakened intramolecular interactions which enhance autophosphorylation of Tyr-419 and subsequent activation. The SH3 domain shows reduced affinity with the linker sequence between the SH2 and kinase domains which may account for the increased basal activity. Displays altered substrate specificity compared to isoform 1, showing weak affinity for synaptophysin and for peptide substrates containing class I or class II SH3 domain-binding motifs. Plays a role in neurite elongation.
Tissue Specificity
Expressed ubiquitously. Platelets, neurons and osteoclasts express 5-fold to 200-fold higher levels than most other tissues.; [Isoform 1]: Expressed in spleen and liver.; [Isoform 2]: Expressed in brain.; [Isoform 3]: Expressed in brain.
KEGG Pathway
EGFR tyrosine ki.se inhibitor resistance (hsa01521 )
Endocrine resistance (hsa01522 )
ErbB sig.ling pathway (hsa04012 )
Rap1 sig.ling pathway (hsa04015 )
Chemokine sig.ling pathway (hsa04062 )
Mitophagy - animal (hsa04137 )
Endocytosis (hsa04144 )
Axon guidance (hsa04360 )
VEGF sig.ling pathway (hsa04370 )
Focal adhesion (hsa04510 )
Adherens junction (hsa04520 )
Tight junction (hsa04530 )
Gap junction (hsa04540 )
Platelet activation (hsa04611 )
Neutrophil extracellular trap formation (hsa04613 )
C-type lectin receptor sig.ling pathway (hsa04625 )
GABAergic sy.pse (hsa04727 )
Inflammatory mediator regulation of TRP channels (hsa04750 )
Regulation of actin cytoskeleton (hsa04810 )
GnRH sig.ling pathway (hsa04912 )
Estrogen sig.ling pathway (hsa04915 )
Prolactin sig.ling pathway (hsa04917 )
Thyroid hormone sig.ling pathway (hsa04919 )
Oxytocin sig.ling pathway (hsa04921 )
Relaxin sig.ling pathway (hsa04926 )
Bacterial invasion of epithelial cells (hsa05100 )
Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120 )
Pathogenic Escherichia coli infection (hsa05130 )
Shigellosis (hsa05131 )
Yersinia infection (hsa05135 )
Tuberculosis (hsa05152 )
Hepatitis B (hsa05161 )
Human cytomegalovirus infection (hsa05163 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Herpes simplex virus 1 infection (hsa05168 )
Viral carcinogenesis (hsa05203 )
Proteoglycans in cancer (hsa05205 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Bladder cancer (hsa05219 )
Lipid and atherosclerosis (hsa05417 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
Nuclear signaling by ERBB4 (R-HSA-1251985 )
Downregulation of ERBB4 signaling (R-HSA-1253288 )
PIP3 activates AKT signaling (R-HSA-1257604 )
GAB1 signalosome (R-HSA-180292 )
Downstream signal transduction (R-HSA-186763 )
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
Integrin signaling (R-HSA-354192 )
GRB2 (R-HSA-354194 )
p130Cas linkage to MAPK signaling for integrins (R-HSA-372708 )
G alpha (s) signalling events (R-HSA-418555 )
G alpha (i) signalling events (R-HSA-418594 )
DCC mediated attractive signaling (R-HSA-418885 )
Netrin mediated repulsion signals (R-HSA-418886 )
Regulation of commissural axon pathfinding by SLIT and ROBO (R-HSA-428542 )
RAF activation (R-HSA-5673000 )
MAP2K and MAPK activation (R-HSA-5674135 )
Signaling by moderate kinase activity BRAF mutants (R-HSA-6802946 )
Signaling by high-kinase activity BRAF mutants (R-HSA-6802948 )
Signaling by BRAF and RAF1 fusions (R-HSA-6802952 )
Paradoxical activation of RAF signaling by kinase inactive BRAF (R-HSA-6802955 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
MET activates PTK2 signaling (R-HSA-8874081 )
InlA-mediated entry of Listeria monocytogenes into host cells (R-HSA-8876493 )
Regulation of RUNX1 Expression and Activity (R-HSA-8934593 )
RUNX2 regulates osteoblast differentiation (R-HSA-8940973 )
Regulation of RUNX3 expression and activity (R-HSA-8941858 )
Extra-nuclear estrogen signaling (R-HSA-9009391 )
RHOU GTPase cycle (R-HSA-9013420 )
Activated NTRK2 signals through FYN (R-HSA-9032500 )
Activated NTRK3 signals through PI3K (R-HSA-9603381 )
Long-term potentiation (R-HSA-9620244 )
GPER1 signaling (R-HSA-9634597 )
Signaling downstream of RAS mutants (R-HSA-9649948 )
Signaling by RAF1 mutants (R-HSA-9656223 )
Signaling by CSF1 (M-CSF) in myeloid cells (R-HSA-9680350 )
Signaling by ERBB2 (R-HSA-1227986 )
BioCyc Pathway
MetaCyc:HS02256-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Thrombocytopenia 6 DISBCBHB Moderate Autosomal dominant [1]
Colorectal cancer DISNH7P9 No Known Unknown [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Carvedilol DMHTEAO Approved Proto-oncogene tyrosine-protein kinase Src (SRC) increases the Vascular disorders ADR of Carvedilol. [53]
Cisplatin DMRHGI9 Approved Proto-oncogene tyrosine-protein kinase Src (SRC) decreases the response to substance of Cisplatin. [54]
Gemcitabine DMSE3I7 Approved Proto-oncogene tyrosine-protein kinase Src (SRC) decreases the response to substance of Gemcitabine. [55]
------------------------------------------------------------------------------------
26 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [3]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [7]
Quercetin DM3NC4M Approved Quercetin decreases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [8]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [15]
Nicotine DMWX5CO Approved Nicotine increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [17]
Ritonavir DMU764S Approved Ritonavir decreases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [20]
Prasterone DM67VKL Approved Prasterone increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [22]
Bosutinib DMTI8YE Approved Bosutinib decreases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [24]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [26]
Buparlisib DM1WEHC Phase 3 Buparlisib increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [28]
Thymoquinone DMVDTR2 Phase 2/3 Thymoquinone decreases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [29]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [30]
XL880 DMHJTR2 Phase 2 XL880 decreases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [32]
G1 DMTV42K Phase 1/2 G1 increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [33]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [34]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [36]
EMODIN DMAEDQG Terminated EMODIN decreases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [38]
AG490 DM3WKO5 Terminated AG490 decreases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [39]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [42]
Chlorpyrifos DMKPUI6 Investigative Chlorpyrifos increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [44]
Tributylstannanyl DMHN7CB Investigative Tributylstannanyl affects the methylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [46]
Dibutyl phthalate DMEDGKO Investigative Dibutyl phthalate increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [47]
Lead acetate DML0GZ2 Investigative Lead acetate increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [48]
Fmet-leu-phe DMQ391A Investigative Fmet-leu-phe increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [49]
[3H]CP55940 DMU7FC5 Investigative [3H]CP55940 increases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [50]
CGP 77675 DMXH2R3 Investigative CGP 77675 decreases the phosphorylation of Proto-oncogene tyrosine-protein kinase Src (SRC). [52]
------------------------------------------------------------------------------------
⏷ Show the Full List of 26 Drug(s)
25 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [4]
Estradiol DMUNTE3 Approved Estradiol increases the activity of Proto-oncogene tyrosine-protein kinase Src (SRC). [5]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [6]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [9]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the activity of Proto-oncogene tyrosine-protein kinase Src (SRC). [11]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [12]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [13]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [14]
Folic acid DMEMBJC Approved Folic acid increases the activity of Proto-oncogene tyrosine-protein kinase Src (SRC). [16]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [13]
Sorafenib DMS8IFC Approved Sorafenib decreases the activity of Proto-oncogene tyrosine-protein kinase Src (SRC). [18]
Diphenylpyraline DMW4X37 Approved Diphenylpyraline increases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [19]
Propofol DMB4OLE Approved Propofol increases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [21]
Sevoflurane DMC9O43 Approved Sevoflurane increases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [21]
Plicamycin DM7C8YV Approved Plicamycin decreases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [23]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the activity of Proto-oncogene tyrosine-protein kinase Src (SRC). [25]
Curcumin DMQPH29 Phase 3 Curcumin decreases the activity of Proto-oncogene tyrosine-protein kinase Src (SRC). [27]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [35]
PMID25656651-Compound-5 DMAI95U Patented PMID25656651-Compound-5 decreases the activity of Proto-oncogene tyrosine-protein kinase Src (SRC). [37]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [40]
Deguelin DMXT7WG Investigative Deguelin increases the activity of Proto-oncogene tyrosine-protein kinase Src (SRC). [41]
QUERCITRIN DM1DH96 Investigative QUERCITRIN affects the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [43]
CH-223191 DMMJZYC Investigative CH-223191 decreases the expression of Proto-oncogene tyrosine-protein kinase Src (SRC). [45]
Benzamidine DM37GWL Investigative Benzamidine decreases the activity of Proto-oncogene tyrosine-protein kinase Src (SRC). [51]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
BAICALEIN DM4C7E6 Phase 2 BAICALEIN affects the binding of Proto-oncogene tyrosine-protein kinase Src (SRC). [31]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Resveratrol and estradiol rapidly activate MAPK signaling through estrogen receptors alpha and beta in endothelial cells. J Biol Chem. 2005 Mar 4;280(9):7460-8. doi: 10.1074/jbc.M411565200. Epub 2004 Dec 22.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
8 Quercetin exerts anti-melanoma activities and inhibits STAT3 signaling. Biochem Pharmacol. 2014 Feb 1;87(3):424-34. doi: 10.1016/j.bcp.2013.11.008. Epub 2013 Nov 23.
9 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
10 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
11 Selective activation of Src family kinases and JNK by low levels of chromium(VI). Toxicol Appl Pharmacol. 2003 Aug 1;190(3):214-23. doi: 10.1016/s0041-008x(03)00188-1.
12 Grouping of histone deacetylase inhibitors and other toxicants disturbing neural crest migration by transcriptional profiling. Neurotoxicology. 2015 Sep;50:56-70.
13 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
14 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
15 Inhibition of Src tyrosine kinase reverts chemoresistance toward 5-fluorouracil in human pancreatic carcinoma cells: an involvement of epidermal growth factor receptor signaling. Oncogene. 2008 Dec 4;27(57):7212-22.
16 Folic acid inhibits endothelial cell migration through inhibiting the RhoA activity mediated by activating the folic acid receptor/cSrc/p190RhoGAP-signaling pathway. Biochem Pharmacol. 2013 Feb 1;85(3):376-84. doi: 10.1016/j.bcp.2012.11.011. Epub 2012 Nov 23.
17 Nicotine promoted colon cancer growth via epidermal growth factor receptor, c-Src, and 5-lipoxygenase-mediated signal pathway. J Pharmacol Exp Ther. 2004 Jan;308(1):66-72. doi: 10.1124/jpet.103.058321. Epub 2003 Oct 20.
18 Sorafenib induces apoptosis in HL60 cells by inhibiting Src kinase-mediated STAT3 phosphorylation. Anticancer Drugs. 2011 Jan;22(1):79-88. doi: 10.1097/CAD.0b013e32833f44fd.
19 Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
20 The human immunodeficiency virus protease inhibitor ritonavir inhibits lung cancer cells, in part, by inhibition of survivin. J Thorac Oncol. 2011 Apr;6(4):661-70. doi: 10.1097/JTO.0b013e31820c9e3c.
21 The differential cancer growth associated with anaesthetics in a cancer xenograft model of mice: mechanisms and implications of postoperative cancer recurrence. Cell Biol Toxicol. 2023 Aug;39(4):1561-1575. doi: 10.1007/s10565-022-09747-9. Epub 2022 Aug 12.
22 Dehydroepiandrosterone Activation of G-protein-coupled Estrogen Receptor Rapidly Stimulates MicroRNA-21 Transcription in Human Hepatocellular Carcinoma Cells. J Biol Chem. 2015 Jun 19;290(25):15799-15811. doi: 10.1074/jbc.M115.641167. Epub 2015 May 11.
23 Mithramycin inhibits human epithelial carcinoma cell proliferation and migration involving downregulation of Eps8 expression. Chem Biol Interact. 2010 Jan 5;183(1):181-6. doi: 10.1016/j.cbi.2009.09.018.
24 SKI-606 decreases growth and motility of colorectal cancer cells by preventing pp60(c-Src)-dependent tyrosine phosphorylation of beta-catenin and its nuclear signaling. Cancer Res. 2006 Feb 15;66(4):2279-86. doi: 10.1158/0008-5472.CAN-05-2057.
25 Changes in androgen receptor nongenotropic signaling correlate with transition of LNCaP cells to androgen independence. Cancer Res. 2004 Oct 1;64(19):7156-68. doi: 10.1158/0008-5472.CAN-04-1121.
26 A Resveratrol Analogue Promotes ERKMAPK-Dependent Stat3 Serine and Tyrosine Phosphorylation Alterations and Antitumor Effects In Vitro against Human Tumor Cells. Mol Pharmacol. 2015 Sep;88(3):524-33. doi: 10.1124/mol.115.099093. Epub 2015 Jul 2.
27 Selective targeting of the inactive state of hematopoietic cell kinase (Hck) with a stable curcumin derivative. J Biol Chem. 2021 Jan-Jun;296:100449. doi: 10.1016/j.jbc.2021.100449. Epub 2021 Feb 20.
28 Combination PI3K/MEK inhibition promotes tumor apoptosis and regression in PIK3CA wild-type, KRAS mutant colorectal cancer. Cancer Lett. 2014 Jun 1;347(2):204-11. doi: 10.1016/j.canlet.2014.02.018. Epub 2014 Feb 24.
29 Thymoquinone induces apoptosis of human epidermoid carcinoma A431?cells through ROS-mediated suppression of STAT3. Chem Biol Interact. 2019 Oct 1;312:108799. doi: 10.1016/j.cbi.2019.108799. Epub 2019 Aug 18.
30 Cadmium stimulates metastasis-associated phenotype in triple-negative breast cancer cells through integrin and -catenin signaling. Toxicol Appl Pharmacol. 2017 Aug 1;328:70-80. doi: 10.1016/j.taap.2017.05.017. Epub 2017 May 17.
31 Mechanism analysis of Buyang Huanwu decoction in treating atherosclerosis based on network pharmacology and in?vitro experiments. Chem Biol Drug Des. 2024 Jan;103(1):e14447. doi: 10.1111/cbdd.14447.
32 LRIG1 modulates cancer cell sensitivity to Smac mimetics by regulating TNF expression and receptor tyrosine kinase signaling. Cancer Res. 2012 Mar 1;72(5):1229-38. doi: 10.1158/0008-5472.CAN-11-2428. Epub 2012 Jan 12.
33 A nongenomic mechanism for "metalloestrogenic" effects of cadmium in human uterine leiomyoma cells through G protein-coupled estrogen receptor. Arch Toxicol. 2019 Oct;93(10):2773-2785. doi: 10.1007/s00204-019-02544-0. Epub 2019 Aug 29.
34 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
35 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
36 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
37 Discovery of 5-(arenethynyl) hetero-monocyclic derivatives as potent inhibitors of BCR-ABL including the T315I gatekeeper mutant. Bioorg Med Chem Lett. 2011 Jun 15;21(12):3743-8.
38 Emodin inhibits growth and induces apoptosis in an orthotopic hepatocellular carcinoma model by blocking activation of STAT3. Br J Pharmacol. 2013 Oct;170(4):807-21. doi: 10.1111/bph.12302.
39 Naphtho[1,2-b]furan-4,5-dione disrupts Janus kinase-2 and induces apoptosis in breast cancer MDA-MB-231 cells. Toxicol In Vitro. 2010 Jun;24(4):1158-67. doi: 10.1016/j.tiv.2010.02.019. Epub 2010 Mar 1.
40 Bisphenol A stimulates the epithelial mesenchymal transition of estrogen negative breast cancer cells via FOXA1 signals. Arch Biochem Biophys. 2015 Nov 1;585:10-16. doi: 10.1016/j.abb.2015.09.006. Epub 2015 Sep 9.
41 A novel derivative of the natural agent deguelin for cancer chemoprevention and therapy. Cancer Prev Res (Phila). 2008 Dec;1(7):577-87. doi: 10.1158/1940-6207.CAPR-08-0184.
42 Ochratoxin A activates opposing c-MET/PI3K/Akt and MAPK/ERK 1-2 pathways in human proximal tubule HK-2 cells. Arch Toxicol. 2015 Aug;89(8):1313-27. doi: 10.1007/s00204-014-1311-x. Epub 2014 Jul 8.
43 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
44 AhR ligands reactivate LINE-1 retrotransposon in triple-negative breast cancer cells MDA-MB-231 and non-tumorigenic mammary epithelial cells NMuMG. Biochem Pharmacol. 2020 May;175:113904. doi: 10.1016/j.bcp.2020.113904. Epub 2020 Mar 8.
45 Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.
46 Persistent organic pollutants alter DNA methylation during human adipocyte differentiation. Toxicol In Vitro. 2017 Apr;40:79-87. doi: 10.1016/j.tiv.2016.12.011. Epub 2016 Dec 20.
47 Phthalates stimulate the epithelial to mesenchymal transition through an HDAC6-dependent mechanism in human breast epithelial stem cells. Toxicol Sci. 2012 Aug;128(2):365-76. doi: 10.1093/toxsci/kfs163. Epub 2012 May 2.
48 Lead acetate induces EGFR activation upstream of SFK and PKCalpha linkage to the Ras/Raf-1/ERK signaling. Toxicol Appl Pharmacol. 2009 Mar 1;235(2):244-52. doi: 10.1016/j.taap.2008.12.007. Epub 2008 Dec 24.
49 The anti-inflammatory effect of 2-(4-hydroxy-3-prop-2-enyl-phenyl)-4-prop-2-enyl-phenol by targeting Lyn kinase in human neutrophils. Chem Biol Interact. 2015 Jul 5;236:90-101. doi: 10.1016/j.cbi.2015.05.004. Epub 2015 May 14.
50 Pyrimidinyl Biphenylureas Act as Allosteric Modulators to Activate Cannabinoid Receptor 1 and Initiate -Arrestin-Dependent Responses. Mol Pharmacol. 2019 Jan;95(1):1-10. doi: 10.1124/mol.118.112854. Epub 2018 Oct 15.
51 Benzamides and benzamidines as specific inhibitors of epidermal growth factor receptor and v-Src protein tyrosine kinases. Bioorg Med Chem. 2004 Jul 1;12(13):3529-42. doi: 10.1016/j.bmc.2004.04.030.
52 Role of aromatase activation on sodium arsenite-induced proliferation, migration, and invasion of MDA-MB-231 and MDA-MB-453 breast cancer cell lines. Toxicology. 2020 May 15;437:152440. doi: 10.1016/j.tox.2020.152440. Epub 2020 Mar 18.
53 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
54 Integrin 1, v, 6 effectors p130Cas, Src and talin regulate carcinoma invasion and chemoresistance. Biochem Biophys Res Commun. 2011 Mar 11;406(2):171-6. doi: 10.1016/j.bbrc.2011.01.109. Epub 2011 Feb 1.
55 Inhibition of SRC tyrosine kinase impairs inherent and acquired gemcitabine resistance in human pancreatic adenocarcinoma cells. Clin Cancer Res. 2004 Apr 1;10(7):2307-18.