Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGDAJRZ)

• DOT Name: Ribosyldihydronicotinamide dehydrogenase (NQO2)
• Synonyms: EC 1.10.5.1; NRH dehydrogenase 2; NRH:quinone oxidoreductase 2; Quinone reductase 2; QR2
• Gene Name: NQO2
• UniProt ID: NQO2_HUMAN
• PDB ID: 1QR2 ; 1SG0 ; 1XI2 ; 1ZX1 ; 2BZS ; 2QMY ; 2QMZ ; 2QR2 ; 2QWX ; 2QX4 ; 2QX6 ; 2QX8 ; 2QX9 ; 3FW1 ; 3G5M ; 3GAM ; 3NFR ; 3NHF ; 3NHJ ; 3NHK ; 3NHL ; 3NHP ; 3NHR ; 3NHS ; 3NHU ; 3NHW ; 3NHY ; 3O2N ; 3O73 ; 3OVM ; 3OWH ; 3OWX ; 3OX1 ; 3OX2 ; 3OX3 ; 3TE7 ; 3TEM ; 3TZB ; 3UXE ; 3UXH ; 4FGJ ; 4FGK ; 4FGL ; 4GQI ; 4GR9 ; 4QOD ; 4QOE ; 4QOF ; 4QOG ; 4QOH ; 4QOI ; 4QOJ ; 4U7F ; 4U7G ; 4U7H ; 4XDG ; 4XDH ; 4ZVK ; 4ZVL ; 4ZVM ; 4ZVN ; 5BUC ; 5LBT ; 5LBU ; 5LBW ; 5LBY ; 5LBZ ; 7O4D
• EC Number: 1.10.5.1
• Pfam ID: PF02525
• Sequence:
  MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
  SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
  LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
  GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
• Function: The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
• Reactome Pathway: Phase I - Functionalization of compounds (R-HSA-211945)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Biotransformations of 5 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Menadione	DMSJDTY	Approved	Ribosyldihydronicotinamide dehydrogenase (NQO2) increases the reduction of Menadione.	[16]
Clozapine	DMFC71L	Approved	Ribosyldihydronicotinamide dehydrogenase (NQO2) increases the reduction of Clozapine.	[16]
Nicotinamide riboside	DMJBYSE	Phase 1	Ribosyldihydronicotinamide dehydrogenase (NQO2) increases the oxidation of Nicotinamide riboside.	[24]
CB1954	DMVP4YK	Discontinued in Phase 2	Ribosyldihydronicotinamide dehydrogenase (NQO2) increases the reduction of CB1954.	[16]
Dichloroindophenol	DMAEI51	Investigative	Ribosyldihydronicotinamide dehydrogenase (NQO2) increases the reduction of Dichloroindophenol.	[16]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paraquat	DMR8O3X	Investigative	Ribosyldihydronicotinamide dehydrogenase (NQO2) increases the response to substance of Paraquat.	[14]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[18]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[6]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[7]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[8]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[9]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[10]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[11]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[12]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[13]
Melatonin	DMKWFBT	Approved	Melatonin affects the activity of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[14]
Tacrine	DM51FY6	Approved	Tacrine decreases the activity of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[16]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[10]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the activity of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[17]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[19]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[20]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[21]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[5]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[22]
(E)-4-(3,5-dimethoxystyryl)phenol	DMYXI2V	Investigative	(E)-4-(3,5-dimethoxystyryl)phenol increases the expression of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[23]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hesperetin	DMKER83	Approved	Hesperetin affects the binding of Ribosyldihydronicotinamide dehydrogenase (NQO2).	[15]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Aberrantly expressed genes in HaCaT keratinocytes chronically exposed to arsenic trioxide. Biomark Insights. 2011 Feb 8;6:7-16.
• [9] Proteomic analysis of liver cancer cells treated with suberonylanilide hydroxamic acid. Cancer Chemother Pharmacol. 2008 Apr;61(5):791-802.
• [10] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [11] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [12] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [13] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [14] The antidote effect of quinone oxidoreductase 2 inhibitor against paraquat-induced toxicity in vitro and in vivo. Br J Pharmacol. 2013 Jan;168(1):46-59. doi: 10.1111/j.1476-5381.2012.01870.x.
• [15] Various concentrations of hesperetin induce different types of programmed cell death in human breast cancerous and normal cell lines in a ROS-dependent manner. Chem Biol Interact. 2023 Sep 1;382:110642. doi: 10.1016/j.cbi.2023.110642. Epub 2023 Jul 23.
• [16] Reduction and scavenging of chemically reactive drug metabolites by NAD(P)H:quinone oxidoreductase 1 and NRH:quinone oxidoreductase 2 and variability in hepatic concentrations. Chem Res Toxicol. 2018 Feb 19;31(2):116-126.
• [17] Design, synthesis, biological and structural evaluation of functionalized resveratrol analogues as inhibitors of quinone reductase 2. Bioorg Med Chem. 2013 Oct 1;21(19):6022-37. doi: 10.1016/j.bmc.2013.07.037. Epub 2013 Jul 27.
• [18] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [19] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [20] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [21] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [22] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [23] Proteomic identification of pterostilbene-mediated anticancer activities in HepG2 cells. Chem Res Toxicol. 2014 Jul 21;27(7):1243-52. doi: 10.1021/tx5001392. Epub 2014 Jul 1.
• [24] Old and new inhibitors of quinone reductase 2. Chem Biol Interact. 2010 Jul 30;186(2):103-9. doi: 10.1016/j.cbi.2010.04.006. Epub 2010 May 4.