Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGM06VJ)

DOT Name Isopentenyl-diphosphate Delta-isomerase 1 (IDI1)
Synonyms EC 5.3.3.2; Isopentenyl pyrophosphate isomerase 1; IPP isomerase 1; IPPI1
Gene Name IDI1
UniProt ID
IDI1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2DHO; 2I6K; 2ICJ; 2ICK
EC Number
5.3.3.2
Pfam ID
PF00293
Sequence
MPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFN
TENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPL
EEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELK
ELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
Function Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).
KEGG Pathway
Terpenoid backbone biosynthesis (hsa00900 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Activation of gene expression by SREBF (SREBP) (R-HSA-2426168 )
Cholesterol biosynthesis (R-HSA-191273 )
BioCyc Pathway
MetaCyc:HS00895-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Fluorouracil DMUM7HZ Approved Isopentenyl-diphosphate Delta-isomerase 1 (IDI1) affects the response to substance of Fluorouracil. [43]
------------------------------------------------------------------------------------
46 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [4]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [5]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [6]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [7]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [8]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [5]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [9]
Progesterone DMUY35B Approved Progesterone increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [10]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [11]
Isotretinoin DM4QTBN Approved Isotretinoin decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [12]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [13]
Nicotine DMWX5CO Approved Nicotine increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [14]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [15]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [16]
Clozapine DMFC71L Approved Clozapine decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [17]
Obeticholic acid DM3Q1SM Approved Obeticholic acid decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [18]
Cyclophosphamide DM4O2Z7 Approved Cyclophosphamide increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [19]
Lucanthone DMZLBUO Approved Lucanthone increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [20]
Benzatropine DMF7EXL Approved Benzatropine decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [17]
Fluoxetine DM3PD2C Approved Fluoxetine increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [21]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [22]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [23]
Isoflavone DM7U58J Phase 4 Isoflavone increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [24]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [25]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [26]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [27]
DNCB DMDTVYC Phase 2 DNCB decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [28]
GSK2110183 DMZHB37 Phase 2 GSK2110183 increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [29]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [30]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [31]
GSK618334 DMJPXZ4 Phase 1 GSK618334 increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [19]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [33]
Eugenol DM7US1H Patented Eugenol decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [28]
Tacedinaline DM1Z74X Discontinued in Phase 2 Tacedinaline increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [34]
UNC0379 DMD1E4J Preclinical UNC0379 increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [35]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [36]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [37]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [38]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [39]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [40]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [41]
Resorcinol DMM37C0 Investigative Resorcinol increases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [13]
Arachidonic acid DMUOQZD Investigative Arachidonic acid decreases the expression of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [42]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Isopentenyl-diphosphate Delta-isomerase 1 (IDI1). [32]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 Hypoxia-inducible factor-1 (HIF-1) pathway activation by quercetin in human lens epithelial cells. Exp Eye Res. 2009 Dec;89(6):995-1002. doi: 10.1016/j.exer.2009.08.011. Epub 2009 Sep 1.
8 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
9 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
10 Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
11 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
12 Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
13 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
14 Nicotinic modulation of gene expression in SH-SY5Y neuroblastoma cells. Brain Res. 2006 Oct 20;1116(1):39-49.
15 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
16 Identification of potential biomarkers for predicting acute dermal irritation by proteomic analysis. J Appl Toxicol. 2011 Nov;31(8):762-72.
17 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
18 Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
19 Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
20 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
21 Screening autism-associated environmental factors in differentiating human neural progenitors with fractional factorial design-based transcriptomics. Sci Rep. 2023 Jun 29;13(1):10519. doi: 10.1038/s41598-023-37488-0.
22 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
23 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
24 Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
25 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
26 Integrated transcriptomic and metabolomic analyses to characterize the anti-cancer effects of (-)-epigallocatechin-3-gallate in human colon cancer cells. Toxicol Appl Pharmacol. 2020 Aug 15;401:115100. doi: 10.1016/j.taap.2020.115100. Epub 2020 Jun 6.
27 Using DNA microarray analyses to elucidate the effects of genistein in androgen-responsive prostate cancer cells: identification of novel targets. Mol Carcinog. 2004 Oct;41(2):108-119.
28 Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
29 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
30 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
31 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
32 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
33 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
34 Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
35 Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
36 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
37 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
38 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
39 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
40 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
41 Evaluation of an in vitro model of androgen ablation and identification of the androgen responsive proteome in LNCaP cells. Proteomics. 2007 Jan;7(1):47-63.
42 Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
43 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.