Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHF0UQU)

• DOT Name: Neurotrimin (NTM)
• Synonyms: hNT; IgLON family member 2
• Gene Name: NTM
• Related Disease:
  Pulmonary disease
  Advanced cancer
  Attention deficit hyperactivity disorder
  Autism spectrum disorder
  Bronchiectasis
  Chronic obstructive pulmonary disease
  Congenital primary aphakia
  Endophthalmitis
  Familial adenomatous polyposis 2
  Gastroesophageal reflux disease
  Late-onset Parkinson disease
  Major depressive disorder
  Megalencephaly
  Mycobacterium infection
  Schizophrenia
  Skin disease
  Tuberculosis
  Neoplasm
  Hepatocellular carcinoma
  Acute myelogenous leukaemia
  Familial medullary thyroid carcinoma
  Medullary thyroid gland carcinoma
  Myopia
  OPTN-related open angle glaucoma
• UniProt ID: NTRI_HUMAN
• PDB ID: 6DLF
• Pfam ID: PF07679 ; PF00047 ; PF13927
• Sequence:
  MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTID
  NRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTD
  NHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFV
  SEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGT
  LQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNK
  LGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF
• Function: Neural cell adhesion molecule.
• Reactome Pathway: Post-translational modification (R-HSA-163125)

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Pulmonary disease	DIS6060I	Definitive	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[3]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[4]
Bronchiectasis	DIS5MYEE	Strong	Biomarker	[5]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Biomarker	[6]
Congenital primary aphakia	DISG5AY9	Strong	Biomarker	[6]
Endophthalmitis	DISCQV4J	Strong	Biomarker	[7]
Familial adenomatous polyposis 2	DIS62W3Y	Strong	Biomarker	[8]
Gastroesophageal reflux disease	DISQ8G5S	Strong	Biomarker	[9]
Late-onset Parkinson disease	DIS9IOUI	Strong	Biomarker	[10]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[11]
Megalencephaly	DISYW5SV	Strong	Genetic Variation	[4]
Mycobacterium infection	DISNSMUD	Strong	Biomarker	[12]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[13]
Skin disease	DISDW8R6	Strong	Biomarker	[14]
Tuberculosis	DIS2YIMD	Strong	Genetic Variation	[15]
Neoplasm	DISZKGEW	moderate	Biomarker	[16]
Hepatocellular carcinoma	DIS0J828	Disputed	Biomarker	[16]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[17]
Familial medullary thyroid carcinoma	DIS01PWX	Limited	Biomarker	[18]
Medullary thyroid gland carcinoma	DISHBL3K	Limited	Biomarker	[18]
Myopia	DISK5S60	Limited	Genetic Variation	[19]
OPTN-related open angle glaucoma	DISDR98A	Limited	Genetic Variation	[20]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Neurotrimin (NTM).	[21]
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Neurotrimin (NTM).	[24]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the methylation of Neurotrimin (NTM).	[28]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Neurotrimin (NTM).	[32]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Neurotrimin (NTM).	[28]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Neurotrimin (NTM).	[22]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Neurotrimin (NTM).	[23]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Neurotrimin (NTM).	[25]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Neurotrimin (NTM).	[26]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Neurotrimin (NTM).	[27]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Neurotrimin (NTM).	[29]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Neurotrimin (NTM).	[30]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Neurotrimin (NTM).	[31]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Neurotrimin (NTM).	[33]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Neurotrimin (NTM).	[34]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Neurotrimin (NTM).	[35]

References

• [1] Non-tuberculous mycobacterial pulmonary disease.Eur Respir J. 2019 Jul 11;54(1):1900250. doi: 10.1183/13993003.00250-2019. Print 2019 Jul.
• [2] An unbalanced translocation involving loss of 10q26.2 and gain of 11q25 in a pedigree with autism spectrum disorder and cerebellar juvenile pilocytic astrocytoma.Am J Med Genet A. 2013 Apr;161A(4):787-91. doi: 10.1002/ajmg.a.35841. Epub 2013 Mar 12.
• [3] Genome-wide analyses of aggressiveness in attention-deficit hyperactivity disorder.Am J Med Genet B Neuropsychiatr Genet. 2016 Jul;171(5):733-47. doi: 10.1002/ajmg.b.32434. Epub 2016 Mar 29.
• [4] 11q24.2-25 micro-rearrangements in autism spectrum disorders: Relation to brain structures.Am J Med Genet A. 2015 Dec;167A(12):3019-30. doi: 10.1002/ajmg.a.37345. Epub 2015 Sep 3.
• [5] US Patient-Centered Research Priorities and Roadmap for Bronchiectasis.Chest. 2018 Nov;154(5):1016-1023. doi: 10.1016/j.chest.2018.06.032. Epub 2018 Jul 5.
• [6] Risk factors for the development of chronic pulmonary aspergillosis in patients with nontuberculous mycobacterial lung disease.PLoS One. 2017 Nov 30;12(11):e0188716. doi: 10.1371/journal.pone.0188716. eCollection 2017.
• [7] Late-onset postoperative Mycobacterium haemophilum endophthalmitis masquerading as inflammatory uveitis: a case report.BMC Infect Dis. 2018 Feb 7;18(1):70. doi: 10.1186/s12879-018-2985-0.
• [8] Investigation of Mycobacterium avium complex (MAC) in Australian commercial milk using qPCR.J Dairy Res. 2017 Feb;84(1):89-91. doi: 10.1017/S0022029916000820.
• [9] Adult Patients With Bronchiectasis: A First Look at the US Bronchiectasis Research Registry.Chest. 2017 May;151(5):982-992. doi: 10.1016/j.chest.2016.10.055. Epub 2016 Nov 23.
• [10] Safety and effectiveness of low-dose amikacin in nontuberculous mycobacterial pulmonary disease treated in Toronto, Canada.BMC Pharmacol Toxicol. 2019 Jun 3;20(1):37. doi: 10.1186/s40360-019-0302-1.
• [11] NTM and NR3C2 polymorphisms influencing intelligence: family-based association studies.Prog Neuropsychopharmacol Biol Psychiatry. 2011 Jan 15;35(1):154-60. doi: 10.1016/j.pnpbp.2010.10.016. Epub 2010 Oct 29.
• [12] Notification of Nontuberculous Mycobacteria: An Australian Perspective.Ann Am Thorac Soc. 2017 Mar;14(3):318-323. doi: 10.1513/AnnalsATS.201612-994OI.
• [13] Pleiotropic Meta-Analysis of Cognition, Education, and Schizophrenia Differentiates Roles of Early Neurodevelopmental and Adult Synaptic Pathways.Am J Hum Genet. 2019 Aug 1;105(2):334-350. doi: 10.1016/j.ajhg.2019.06.012.
• [14] Management of infections due to nontuberculous mycobacteria in solid organ transplant recipients-Guidelines from the American Society of Transplantation Infectious Diseases Community of Practice.Clin Transplant. 2019 Sep;33(9):e13588. doi: 10.1111/ctr.13588. Epub 2019 Jun 25.
• [15] Interrelational changes in the epidemiology and clinical features of nontuberculous mycobacterial pulmonary disease and tuberculosis in a referral hospital in Japan.Respir Med. 2019 Jun;152:74-80. doi: 10.1016/j.rmed.2019.05.001. Epub 2019 May 8.
• [16] No-touch multibipolar radiofrequency ablation vs. surgical resection for solitary hepatocellular carcinoma ranging from 2 to 5cm.J Hepatol. 2018 Jun;68(6):1172-1180. doi: 10.1016/j.jhep.2018.01.014. Epub 2018 Feb 2.
• [17] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [18] Differential detection of tuberculous and non-tuberculous mycobacteria by qPCR in lavage fluids of tuberculosis-suspicious white rhinoceros.PLoS One. 2018 Nov 28;13(11):e0207365. doi: 10.1371/journal.pone.0207365. eCollection 2018.
• [19] Detection and interpretation of shared genetic influences on 42 human traits.Nat Genet. 2016 Jul;48(7):709-17. doi: 10.1038/ng.3570. Epub 2016 May 16.
• [20] Genome-wide analysis of central corneal thickness in primary open-angle glaucoma cases in the NEIGHBOR and GLAUGEN consortia.Invest Ophthalmol Vis Sci. 2012 Jul 3;53(8):4468-74. doi: 10.1167/iovs.12-9784.
• [21] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [22] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [23] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [24] Differential DNA methylation profile of key genes in malignant prostate epithelial cells transformed by inorganic arsenic or cadmium. Toxicol Appl Pharmacol. 2015 Aug 1;286(3):159-67.
• [25] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [26] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [27] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [28] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [29] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [30] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [31] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [32] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [33] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [34] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [35] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.