Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHTU98X)

• DOT Name: Pregnancy-specific beta-1-glycoprotein 5 (PSG5)
• Synonyms: PS-beta-G-5; PSBG-5; Pregnancy-specific glycoprotein 5; Fetal liver non-specific cross-reactive antigen 3; FL-NCA-3
• Gene Name: PSG5
• Related Disease:
  Leishmaniasis
  Neoplasm
  Parkinson disease
  Attention deficit hyperactivity disorder
  Cervical cancer
  Cervical carcinoma
  Epithelial ovarian cancer
  Hepatocellular carcinoma
  High blood pressure
  Huntington disease
  Hydatidiform mole
  Hydatidiform mole, recurrent, 1
  Hypersomnia
  Inflammatory bowel disease
  Insomnia
  Narcolepsy
  Obesity
  Obstructive sleep apnea
  Ovarian cancer
  Ovarian neoplasm
  Panic disorder
  Pre-eclampsia
  Promyelocytic leukaemia
  Rheumatoid arthritis
  Sleep apnea syndrome
  Sleep disorder
  Eclampsia
  Fetal growth restriction
  Narcolepsy type 1
  Familial medullary thyroid carcinoma
  Medullary thyroid gland carcinoma
• UniProt ID: PSG5_HUMAN
• Pfam ID: PF13895 ; PF13927 ; PF07686
• Sequence:
  MGPLSAPPCTQHITWKGLLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQ
  NLAGYIWYKGQLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSY
  TLHIIKRGDRTRGVTGYFTFNLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIW
  WLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYECEIRDRDGGMRSDPVTLNVLYGPD
  LPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQQSGQKLSIPQITTKHRGLYT
  CSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI
• Tissue Specificity: Synthesized by syncytiotrophoblast of the placenta.
• Reactome Pathway: Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DOT

31 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Leishmaniasis	DISABTW7	Definitive	Biomarker	[1]
Neoplasm	DISZKGEW	Definitive	Biomarker	[2]
Parkinson disease	DISQVHKL	Definitive	Genetic Variation	[3]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Biomarker	[4]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[5]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[5]
Epithelial ovarian cancer	DIS56MH2	Strong	Genetic Variation	[6]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[7]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[8]
Huntington disease	DISQPLA4	Strong	Biomarker	[9]
Hydatidiform mole	DISKNP7O	Strong	Genetic Variation	[10]
Hydatidiform mole, recurrent, 1	DISXUJWE	Strong	Genetic Variation	[10]
Hypersomnia	DISKYOM6	Strong	Biomarker	[11]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[12]
Insomnia	DIS0AFR7	Strong	Biomarker	[13]
Narcolepsy	DISLCNLI	Strong	Biomarker	[11]
Obesity	DIS47Y1K	Strong	Altered Expression	[14]
Obstructive sleep apnea	DIS0SVD1	Strong	Biomarker	[15]
Ovarian cancer	DISZJHAP	Strong	Genetic Variation	[6]
Ovarian neoplasm	DISEAFTY	Strong	Genetic Variation	[6]
Panic disorder	DISD3VNY	Strong	Biomarker	[16]
Pre-eclampsia	DISY7Q29	Strong	Altered Expression	[17]
Promyelocytic leukaemia	DISYGG13	Strong	Altered Expression	[18]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[19]
Sleep apnea syndrome	DISER6KS	Strong	Biomarker	[20]
Sleep disorder	DIS3JP1U	Strong	Genetic Variation	[21]
Eclampsia	DISWPO8U	moderate	Genetic Variation	[22]
Fetal growth restriction	DIS5WEJ5	moderate	Genetic Variation	[22]
Narcolepsy type 1	DISH7Y6Q	moderate	Biomarker	[23]
Familial medullary thyroid carcinoma	DIS01PWX	Limited	Genetic Variation	[24]
Medullary thyroid gland carcinoma	DISHBL3K	Limited	Genetic Variation	[24]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Pregnancy-specific beta-1-glycoprotein 5 (PSG5).	[25]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Pregnancy-specific beta-1-glycoprotein 5 (PSG5).	[26]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Pregnancy-specific beta-1-glycoprotein 5 (PSG5).	[19]
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Pregnancy-specific beta-1-glycoprotein 5 (PSG5).	[28]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Pregnancy-specific beta-1-glycoprotein 5 (PSG5).	[29]

References

• [1] Promastigote secretory gel from natural and unnatural sand fly vectors exacerbate Leishmania major and Leishmania tropica cutaneous leishmaniasis in mice.Parasitology. 2019 Dec;146(14):1796-1802. doi: 10.1017/S0031182019001069. Epub 2019 Aug 29.
• [2] A polymerase-chain-reaction assay for the specific identification of transcripts encoded by individual carcinoembryonic antigen (CEA)-gene-family members.Int J Cancer. 1993 Sep 9;55(2):311-9. doi: 10.1002/ijc.2910550223.
• [3] Clinical variations in Parkinson's disease patients with or without REM sleep behaviour disorder: a meta-analysis.Sci Rep. 2017 Jan 16;7:40779. doi: 10.1038/srep40779.
• [4] Sleep phenotypes in attention deficit hyperactivity disorder.Sleep Med. 2019 Aug;60:123-131. doi: 10.1016/j.sleep.2018.08.026. Epub 2018 Sep 20.
• [5] Krppel-Like Factor 10 participates in cervical cancer immunoediting through transcriptional regulation of Pregnancy-Specific Beta-1 Glycoproteins.Sci Rep. 2018 Jun 21;8(1):9445. doi: 10.1038/s41598-018-27711-8.
• [6] Evaluation of copy-number variants as modifiers of breast and ovarian cancer risk for BRCA1 pathogenic variant carriers.Eur J Hum Genet. 2017 Apr;25(4):432-438. doi: 10.1038/ejhg.2016.203. Epub 2017 Feb 1.
• [7] Transfected human liver cytochrome P-450 hydroxylates vitamin D analogs at different side-chain positions.Proc Natl Acad Sci U S A. 1993 Sep 15;90(18):8668-72. doi: 10.1073/pnas.90.18.8668.
• [8] Entropy-based measures of EEG arousals as biomarkers for sleep dynamics: applications to hypertension.Sleep. 2008 Jul;31(7):935-43.
• [9] Subjective Assessment of Sleep in Huntington Disease: Reliability of Sleep Questionnaires Compared to Polysomnography.Neurodegener Dis. 2017;17(6):330-337. doi: 10.1159/000480701. Epub 2017 Nov 24.
• [10] Linkage of two human pregnancy-specific beta 1-glycoprotein genes: one is associated with hydatidiform mole.Proc Natl Acad Sci U S A. 1990 Aug;87(15):5822-6. doi: 10.1073/pnas.87.15.5822.
• [11] Prevalence, risk factors, and response to treatment for hypersomnia of central origin in survivors of childhood brain tumors.J Neurooncol. 2018 Jan;136(2):379-384. doi: 10.1007/s11060-017-2662-y. Epub 2017 Nov 8.
• [12] Evaluation of Home Polysomnography Findings, Quality of Sleep, and Fatigue in Inflammatory Bowel Disease: A Case Series.J Clin Sleep Med. 2019 Jan 15;15(1):39-45. doi: 10.5664/jcsm.7566.
• [13] The Relationship Between PSG and Morning/Evening Emotional Parameters in Patients With Insomnia Disorder and Good Sleepers.Front Psychol. 2019 Jan 10;9:2712. doi: 10.3389/fpsyg.2018.02712. eCollection 2018.
• [14] Lifetime Self-Harm Behaviors Are Not More Prevalent in Bariatric Surgery Candidates than in Community Controls with Obesity.Obes Facts. 2018;11(2):109-115. doi: 10.1159/000486484. Epub 2018 Apr 10.
• [15] Is Maxillomandibular Advancement Associated With Comorbidity Reduction in Patients With Obstructive Sleep Apnea?.J Oral Maxillofac Surg. 2019 May;77(5):1044-1049. doi: 10.1016/j.joms.2018.12.006. Epub 2018 Dec 17.
• [16] Calibrating actigraphy to improve sleep efficiency estimates.J Sleep Res. 2018 Aug;27(4):e12613. doi: 10.1111/jsr.12613. Epub 2017 Oct 24.
• [17] Placenta-derived, cellular messenger RNA expression in the maternal blood of preeclamptic women.Obstet Gynecol. 2007 Nov;110(5):1130-6. doi: 10.1097/01.AOG.0000286761.11436.67.
• [18] A pregnancy-specific beta 1-glycoprotein, a CEA gene family member, expressed in a human promyelocytic leukemia cell line, HL-60: structures of protein, mRNA and gene.Biochem Biophys Res Commun. 1989 Sep 15;163(2):1021-31. doi: 10.1016/0006-291x(89)92324-3.
• [19] Gene expression profiling of rheumatoid arthritis synovial cells treated with antirheumatic drugs. J Biomol Screen. 2007 Apr;12(3):328-40. doi: 10.1177/1087057107299261. Epub 2007 Mar 22.
• [20] Blood count values and ratios for predicting sleep apnea in obese children.Int J Pediatr Otorhinolaryngol. 2017 Jul;98:85-90. doi: 10.1016/j.ijporl.2017.04.043. Epub 2017 May 1.
• [21] Clinical and video-polysomnographic analysis of rapid eye movement sleep behavior disorder and other sleep disturbances in dementia with Lewy bodies.Sleep. 2019 Jul 8;42(7):zsz086. doi: 10.1093/sleep/zsz086.
• [22] Characterization of Human Pregnancy Specific Glycoprotein (PSG) Gene Copy Number Variations in Pre-eclampsia Patients.Adv Exp Med Biol. 2016;924:63-65. doi: 10.1007/978-3-319-42044-8_12.
• [23] Clinical, polysomnographic and genome-wide association analyses of narcolepsy with cataplexy: a European Narcolepsy Network study.J Sleep Res. 2013 Oct;22(5):482-95. doi: 10.1111/jsr.12044. Epub 2013 Mar 18.
• [24] Prospective trial of unilateral surgery for nonhereditary medullary thyroid carcinoma in patients without germline RET mutations.World J Surg. 2002 Aug;26(8):1023-8. doi: 10.1007/s00268-002-6665-1. Epub 2002 May 21.
• [25] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [26] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [27] Gene expression profiling of rheumatoid arthritis synovial cells treated with antirheumatic drugs. J Biomol Screen. 2007 Apr;12(3):328-40. doi: 10.1177/1087057107299261. Epub 2007 Mar 22.
• [28] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [29] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.