Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJBP360)

DOT Name Prolactin-releasing peptide (PRLH)
Synonyms PrRP; Prolactin-releasing hormone
Gene Name PRLH
Related Disease
Advanced cancer ( )
Alzheimer disease ( )
Amyloidosis ( )
Benign prostatic hyperplasia ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Congenital contractural arachnodactyly ( )
Ductal breast carcinoma in situ ( )
Inflammatory breast cancer ( )
Neoplasm ( )
Obesity ( )
Pituitary adenoma ( )
Pituitary gland disorder ( )
Prostate cancer ( )
Prostate carcinoma ( )
Varicose veins ( )
Tauopathy ( )
UniProt ID
PRRP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15172
Sequence
MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATL
GDVPKPGLRPRLTCFPLEGGAMSSQDG
Function Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL.
Tissue Specificity Medulla oblongata and hypothalamus.
KEGG Pathway
Neuroactive ligand-receptor interaction (hsa04080 )
Reactome Pathway
Peptide ligand-binding receptors (R-HSA-375276 )

Molecular Interaction Atlas (MIA) of This DOT

18 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Alzheimer disease DISF8S70 Strong Posttranslational Modification [2]
Amyloidosis DISHTAI2 Strong Biomarker [3]
Benign prostatic hyperplasia DISI3CW2 Strong Altered Expression [4]
Breast cancer DIS7DPX1 Strong Biomarker [1]
Breast carcinoma DIS2UE88 Strong Biomarker [1]
Breast neoplasm DISNGJLM Strong Biomarker [1]
Congenital contractural arachnodactyly DISOM1K7 Strong Biomarker [5]
Ductal breast carcinoma in situ DISLCJY7 Strong Biomarker [1]
Inflammatory breast cancer DIS3QRWA Strong Biomarker [1]
Neoplasm DISZKGEW Strong Biomarker [5]
Obesity DIS47Y1K Strong Biomarker [6]
Pituitary adenoma DISJ5R1X Strong Altered Expression [7]
Pituitary gland disorder DIS7XB48 Strong Altered Expression [7]
Prostate cancer DISF190Y Strong Altered Expression [4]
Prostate carcinoma DISMJPLE Strong Altered Expression [4]
Varicose veins DISIMBN2 Strong Biomarker [8]
Tauopathy DISY2IPA Limited Biomarker [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 18 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Prolactin-releasing peptide (PRLH). [10]
------------------------------------------------------------------------------------

References

1 Proline-Rich Homeodomain protein (PRH/HHEX) is a suppressor of breast tumour growth.Oncogenesis. 2017 Jun 12;6(6):e346. doi: 10.1038/oncsis.2017.42.
2 Lipidized Prolactin-Releasing Peptide Agonist Attenuates Hypothermia-Induced Tau Hyperphosphorylation in Neurons.J Alzheimers Dis. 2019;67(4):1187-1200. doi: 10.3233/JAD-180837.
3 Liraglutide and a lipidized analog of prolactin-releasing peptide show neuroprotective effects in a mouse model of -amyloid pathology.Neuropharmacology. 2019 Jan;144:377-387. doi: 10.1016/j.neuropharm.2018.11.002. Epub 2018 Nov 11.
4 CK2 abrogates the inhibitory effects of PRH/HHEX on prostate cancer cell migration and invasion and acts through PRH to control cell proliferation.Oncogenesis. 2017 Jan 30;6(1):e293. doi: 10.1038/oncsis.2016.82.
5 A Runaway PRH/HHEX-Notch3-Positive Feedback Loop Drives Cholangiocarcinoma and Determines Response to CDK4/6 Inhibition.Cancer Res. 2020 Feb 15;80(4):757-770. doi: 10.1158/0008-5472.CAN-19-0942. Epub 2019 Dec 16.
6 Metabolomic Study of Obesity and Its Treatment with Palmitoylated Prolactin-Releasing Peptide Analog in Spontaneously Hypertensive and Normotensive Rats.J Proteome Res. 2019 Apr 5;18(4):1735-1750. doi: 10.1021/acs.jproteome.8b00964. Epub 2019 Mar 11.
7 Does prolactin releasing peptide receptor regulate prolactin-secretion in human pituitary adenomas?.Neurosci Lett. 2000 Sep 22;291(3):159-62. doi: 10.1016/s0304-3940(00)01413-0.
8 GLP-1 neurons form a local synaptic circuit within the rodent nucleus of the solitary tract.J Comp Neurol. 2018 Oct 1;526(14):2149-2164. doi: 10.1002/cne.24482. Epub 2018 Sep 19.
9 Novel Lipidized Analog of Prolactin-Releasing Peptide Improves Memory Impairment and Attenuates Hyperphosphorylation of Tau Protein in a Mouse Model of Tauopathy.J Alzheimers Dis. 2018;62(4):1725-1736. doi: 10.3233/JAD-171041.
10 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.