Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJG2JQY)

• DOT Name: SPARC-related modular calcium-binding protein 1 (SMOC1)
• Synonyms: Secreted modular calcium-binding protein 1; SMOC-1
• Gene Name: SMOC1
• Related Disease:
  Aarskog-Scott syndrome, X-linked
  Microphthalmia with limb anomalies
  Syndactyly
  Cervical Intraepithelial neoplasia
  Cleft palate
  Dengue
  Encephalitis
  Glioma
  Hepatitis B virus infection
  Hepatitis C virus infection
  Holt-Oram syndrome
  Isolated cleft palate
  Nail-patella syndrome
  Neoplasm
  Neuroblastoma
  Polydactyly
  rubella
  Rubinstein-Taybi syndrome
  Thrombocytopenia-absent radius syndrome
  Trichohepatoenteric syndrome
  Urticaria
  Darier disease
  Intellectual disability
  Patent ductus arteriosus
  Systemic sclerosis
  Type-1 diabetes
• UniProt ID: SMOC1_HUMAN
• Pfam ID: PF07648 ; PF10591 ; PF16597 ; PF00086
• Sequence:
  MLPARCARLLTPHLLLVLVQLSPARGHRTTGPRFLISDRDPQCNLHCSRTQPKPICASDG
  RSYESMCEYQRAKCRDPTLGVVHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECGE
  DGSFTQVQCHTYTGYCWCVTPDGKPISGSSVQNKTPVCSGSVTDKPLSQGNSGRKDDGSK
  PTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNSEKVYSCDQERQSALEEAQQ
  NPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPLPGTSTRYVMPSCESDARAKT
  TEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLE
  ERVVHWYFSQLDSNSSNDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPE
  LKGCLGVSKEGRLV
• Function: Plays essential roles in both eye and limb development. Probable regulator of osteoblast differentiation.
• Tissue Specificity: Widely expressed in many tissues with a strongest signal in ovary. No expression in spleen.

Molecular Interaction Atlas (MIA) of This DOT

26 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Aarskog-Scott syndrome, X-linked	DISNHV62	Definitive	Biomarker	[1]
Microphthalmia with limb anomalies	DIS19E4H	Definitive	Autosomal recessive	[2]
Syndactyly	DISZK2BT	Definitive	Biomarker	[3]
Cervical Intraepithelial neoplasia	DISXP757	Strong	Altered Expression	[4]
Cleft palate	DIS6G5TF	Strong	Genetic Variation	[5]
Dengue	DISKH221	Strong	Genetic Variation	[6]
Encephalitis	DISLD1RL	Strong	Altered Expression	[7]
Glioma	DIS5RPEH	Strong	Biomarker	[8]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[9]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[10]
Holt-Oram syndrome	DISBNDZ2	Strong	Biomarker	[3]
Isolated cleft palate	DISV80CD	Strong	Genetic Variation	[5]
Nail-patella syndrome	DIS8C4CT	Strong	Biomarker	[3]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[11]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[12]
Polydactyly	DIS25BMZ	Strong	Biomarker	[13]
rubella	DISXUI9P	Strong	Genetic Variation	[14]
Rubinstein-Taybi syndrome	DISVF1HM	Strong	Biomarker	[3]
Thrombocytopenia-absent radius syndrome	DIS5CVW9	Strong	Biomarker	[3]
Trichohepatoenteric syndrome	DISL3ODF	Strong	Genetic Variation	[15]
Urticaria	DIS9WQAI	Strong	Altered Expression	[7]
Darier disease	DIS4WI7S	Limited	Genetic Variation	[16]
Intellectual disability	DISMBNXP	Limited	Biomarker	[17]
Patent ductus arteriosus	DIS9P8YS	Limited	Biomarker	[18]
Systemic sclerosis	DISF44L6	Limited	Biomarker	[19]
Type-1 diabetes	DIS7HLUB	Limited	Genetic Variation	[20]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[21]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[22]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[23]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[24]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[25]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[26]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[27]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[28]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[28]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[29]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[30]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[28]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[28]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[31]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[32]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[34]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[35]
BRN-3548355	DM4KXT0	Investigative	BRN-3548355 increases the expression of SPARC-related modular calcium-binding protein 1 (SMOC1).	[36]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of SPARC-related modular calcium-binding protein 1 (SMOC1).	[33]

References

• [1] Aarskog-Scott syndrome: confirmation of linkage to the pericentromeric region of the X chromosome.Am J Med Genet. 1994 Sep 1;52(3):339-45. doi: 10.1002/ajmg.1320520317.
• [2] A locus for ophthalmo-acromelic syndrome mapped to 10p11.23. Am J Med Genet A. 2009 Mar;149A(3):336-42. doi: 10.1002/ajmg.a.32656.
• [3] SMOC1 is essential for ocular and limb development in humans and mice. Am J Hum Genet. 2011 Jan 7;88(1):30-41. doi: 10.1016/j.ajhg.2010.11.012. Epub 2010 Dec 30.
• [4] Local expression of interferon-alpha and interferon receptors in cervical intraepithelial neoplasia.Cancer Immunol Immunother. 2009 Dec;58(12):2003-10. doi: 10.1007/s00262-009-0707-6. Epub 2009 Apr 18.
• [5] Loss of the BMP antagonist, SMOC-1, causes Ophthalmo-acromelic (Waardenburg Anophthalmia) syndrome in humans and mice.PLoS Genet. 2011 Jul;7(7):e1002114. doi: 10.1371/journal.pgen.1002114. Epub 2011 Jul 7.
• [6] High Anti-Dengue Virus Activity of the OAS Gene Family Is Associated With Increased Severity of Dengue.J Infect Dis. 2015 Dec 15;212(12):2011-20. doi: 10.1093/infdis/jiv321. Epub 2015 Jun 10.
• [7] OAS Gene Family Expression Is Associated with HIV-Related Neurocognitive Disorders.Mol Neurobiol. 2018 Mar;55(3):1905-1914. doi: 10.1007/s12035-017-0460-3. Epub 2017 Feb 24.
• [8] Seven genes for the prognostic prediction in patients with glioma.Clin Transl Oncol. 2019 Oct;21(10):1327-1335. doi: 10.1007/s12094-019-02057-3. Epub 2019 Feb 14.
• [9] Polymorphisms of interferon-inducible genes OAS associated with interferon- treatment response in chronic HBV infection.Antiviral Res. 2011 Mar;89(3):232-7. doi: 10.1016/j.antiviral.2011.01.006. Epub 2011 Jan 28.
• [10] Invivo treatment of HCV core-positive HepG2 cells with the transfer of recombinant caspase-3 using a 2'-5' OAS promoter.Mol Med Rep. 2012 Mar;5(3):631-6. doi: 10.3892/mmr.2011.703. Epub 2011 Dec 9.
• [11] Personalized axillary dissection: the number of excised lymph nodes of nodal-positive breast cancer patients has no significant impact on relapse-free and overall survival.J Cancer Res Clin Oncol. 2017 Sep;143(9):1823-1831. doi: 10.1007/s00432-017-2425-3. Epub 2017 Apr 24.
• [12] Induction of 2.5 OAS gene expression and activity is not sufficient for IFN-gamma-induced neuroblastoma cell differentiation.Int J Cancer. 1995 Jul 17;62(2):223-9. doi: 10.1002/ijc.2910620219.
• [13] Mutations in the SPARC-related modular calcium-binding protein 1 gene, SMOC1, cause waardenburg anophthalmia syndrome.Am J Hum Genet. 2011 Jan 7;88(1):92-8. doi: 10.1016/j.ajhg.2010.12.002. Epub 2010 Dec 30.
• [14] 2'-5'-Oligoadenylate synthetase single-nucleotide polymorphisms and haplotypes are associated with variations in immune responses to rubella vaccine.Hum Immunol. 2010 Apr;71(4):383-91. doi: 10.1016/j.humimm.2010.01.004. Epub 2010 Jan 31.
• [15] Ophthalmo-acromelic syndrome in an infant.Eur J Med Genet. 2019 Jul;62(7):103664. doi: 10.1016/j.ejmg.2019.05.003. Epub 2019 May 5.
• [16] Refined genetic mapping of the darier locus to a <1-cM region of chromosome 12q24.1, and construction of a complete, high-resolution P1 artificial chromosome/bacterial artificial chromosome contig of the critical region.Am J Hum Genet. 1998 Apr;62(4):890-903. doi: 10.1086/301794.
• [17] Additional case of craniofacial and digital anomalies as reported by Harrod et al.Am J Med Genet. 1996 Jan 11;61(2):168-70. doi: 10.1002/(SICI)1096-8628(19960111)61:2<168::AID-AJMG13>3.0.CO;2-S.
• [18] Resistance of pancreatic cancer cells to oncolytic vesicular stomatitis virus: role of type I interferon signaling.Virology. 2013 Feb 5;436(1):221-34. doi: 10.1016/j.virol.2012.11.014. Epub 2012 Dec 14.
• [19] Differential upregulation of human 2'5'OAS genes on systemic sclerosis: Detection of increased basal levels of OASL and OAS2 genes through a qPCR based assay.Autoimmunity. 2014 Mar;47(2):119-26. doi: 10.3109/08916934.2013.866102. Epub 2013 Dec 12.
• [20] Type 1 diabetes and the OAS gene cluster: association with splicing polymorphism or haplotype?.J Med Genet. 2006 Feb;43(2):129-32. doi: 10.1136/jmg.2005.035212. Epub 2005 Jul 13.
• [21] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [22] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [23] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [24] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [25] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [26] Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
• [27] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [28] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [29] Cardiac toxicity from ethanol exposure in human-induced pluripotent stem cell-derived cardiomyocytes. Toxicol Sci. 2019 May 1;169(1):280-292.
• [30] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [31] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [32] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [33] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [34] Proteomics and disease network associations evaluation of environmentally relevant Bisphenol A concentrations in a human 3D neural stem cell model. Front Cell Dev Biol. 2023 Aug 16;11:1236243. doi: 10.3389/fcell.2023.1236243. eCollection 2023.
• [35] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [36] Gene expression profiles in HPV-immortalized human cervical cells treated with the nicotine-derived carcinogen 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone. Chem Biol Interact. 2009 Feb 12;177(3):173-80. doi: 10.1016/j.cbi.2008.10.051. Epub 2008 Nov 6.