Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJH64IV)

• DOT Name: Transcriptional activator Myb (MYB)
• Synonyms: Proto-oncogene c-Myb
• Gene Name: MYB
• UniProt ID: MYB_HUMAN
• Pfam ID: PF09316 ; PF07988 ; PF00249
• Sequence:
  MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGT
  DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
  HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
  IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTV
  NNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
  LLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
  PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLT
  STPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIK
  YGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNF
  FCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASP
  LQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM
• Function: Transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.
• KEGG Pathway: PI3K-Akt sig.ling pathway (hsa04151)
• Reactome Pathway:
  Estrogen-dependent gene expression (R-HSA-9018519)
  Transcriptional regulation of granulopoiesis (R-HSA-9616222)
  Factors involved in megakaryocyte development and platelet production (R-HSA-983231)
  RUNX1 regulates transcription of genes involved in differentiation of HSCs (R-HSA-8939236)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Irinotecan	DMP6SC2	Approved	Transcriptional activator Myb (MYB) increases the response to substance of Irinotecan.	[34]
Indomethacin	DMSC4A7	Approved	Transcriptional activator Myb (MYB) increases the Apoptosis ADR of Indomethacin.	[35]
Mitoxantrone	DMM39BF	Approved	Transcriptional activator Myb (MYB) increases the Apoptosis ADR of Mitoxantrone.	[35]
Capecitabine	DMTS85L	Approved	Transcriptional activator Myb (MYB) increases the response to substance of Capecitabine.	[34]

41 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Transcriptional activator Myb (MYB).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Transcriptional activator Myb (MYB).	[2]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Transcriptional activator Myb (MYB).	[3]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Transcriptional activator Myb (MYB).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Transcriptional activator Myb (MYB).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Transcriptional activator Myb (MYB).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Transcriptional activator Myb (MYB).	[2]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Transcriptional activator Myb (MYB).	[7]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Transcriptional activator Myb (MYB).	[8]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Transcriptional activator Myb (MYB).	[9]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Transcriptional activator Myb (MYB).	[10]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Transcriptional activator Myb (MYB).	[11]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Transcriptional activator Myb (MYB).	[12]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Transcriptional activator Myb (MYB).	[13]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Transcriptional activator Myb (MYB).	[14]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Transcriptional activator Myb (MYB).	[15]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Transcriptional activator Myb (MYB).	[12]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Transcriptional activator Myb (MYB).	[16]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Transcriptional activator Myb (MYB).	[17]
Thalidomide	DM70BU5	Approved	Thalidomide decreases the activity of Transcriptional activator Myb (MYB).	[18]
Estrone	DM5T6US	Approved	Estrone increases the expression of Transcriptional activator Myb (MYB).	[12]
Mestranol	DMG3F94	Approved	Mestranol increases the expression of Transcriptional activator Myb (MYB).	[12]
Clofibrate	DMPC1J7	Approved	Clofibrate decreases the expression of Transcriptional activator Myb (MYB).	[14]
Ciprofibrate	DMGC5DB	Approved	Ciprofibrate decreases the expression of Transcriptional activator Myb (MYB).	[14]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Transcriptional activator Myb (MYB).	[19]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Transcriptional activator Myb (MYB).	[20]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Transcriptional activator Myb (MYB).	[22]
DNCB	DMDTVYC	Phase 2	DNCB decreases the expression of Transcriptional activator Myb (MYB).	[23]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Transcriptional activator Myb (MYB).	[25]
Eugenol	DM7US1H	Patented	Eugenol decreases the expression of Transcriptional activator Myb (MYB).	[23]
HEXESTROL	DM9AGWQ	Withdrawn from market	HEXESTROL increases the expression of Transcriptional activator Myb (MYB).	[12]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Transcriptional activator Myb (MYB).	[26]
Calphostin C	DM9X2D0	Terminated	Calphostin C decreases the expression of Transcriptional activator Myb (MYB).	[27]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Transcriptional activator Myb (MYB).	[3]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Transcriptional activator Myb (MYB).	[28]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Transcriptional activator Myb (MYB).	[29]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Transcriptional activator Myb (MYB).	[30]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Transcriptional activator Myb (MYB).	[31]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Transcriptional activator Myb (MYB).	[32]
15-deoxy-Delta(12, 14)-prostaglandin J(2)	DM8VUX3	Investigative	15-deoxy-Delta(12, 14)-prostaglandin J(2) decreases the expression of Transcriptional activator Myb (MYB).	[14]
Benzoquinone	DMNBA0G	Investigative	Benzoquinone increases the activity of Transcriptional activator Myb (MYB).	[33]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Rigosertib	DMOSTXF	Phase 3	Rigosertib affects the localization of Transcriptional activator Myb (MYB).	[21]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transcriptional activator Myb (MYB).	[24]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
• [3] Bisphenol-A and estradiol exert novel gene regulation in human MCF-7 derived breast cancer cells. Mol Cell Endocrinol. 2004 Jun 30;221(1-2):47-55. doi: 10.1016/j.mce.2004.04.010.
• [4] Inhibition of prostate cancer cell colony formation by the flavonoid quercetin correlates with modulation of specific regulatory genes. Clin Diagn Lab Immunol. 2004 Jan;11(1):63-9. doi: 10.1128/cdli.11.1.63-69.2004.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [7] Induction of apoptosis in U937 human leukemia cells by suberoylanilide hydroxamic acid (SAHA) proceeds through pathways that are regulated by Bcl-2/Bcl-XL, c-Jun, and p21CIP1, but independent of p53. Oncogene. 1999 Nov 25;18(50):7016-25. doi: 10.1038/sj.onc.1203176.
• [8] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [9] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [10] Progestins regulate genes that can elicit both proliferative and antiproliferative effects in breast cancer cells. Oncol Rep. 2008 Jun;19(6):1627-34.
• [11] Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
• [12] Moving toward integrating gene expression profiling into high-throughput testing: a gene expression biomarker accurately predicts estrogen receptor alpha modulation in a microarray compendium. Toxicol Sci. 2016 May;151(1):88-103.
• [13] Glucocorticoids inhibit cell death in ovarian cancer and up-regulate caspase inhibitor cIAP2. Clin Cancer Res. 2005 Sep 1;11(17):6325-32. doi: 10.1158/1078-0432.CCR-05-0182.
• [14] Peroxisome proliferator-activated receptor ligands affect growth-related gene expression in human leukemic cells. J Pharmacol Exp Ther. 2003 Jun;305(3):932-42. doi: 10.1124/jpet.103.049098. Epub 2003 Mar 20.
• [15] Hypomethylation mediated by decreased DNMTs involves in the activation of proto-oncogene MPL in TK6 cells treated with hydroquinone. Toxicol Lett. 2012 Mar 25;209(3):239-45. doi: 10.1016/j.toxlet.2011.12.020. Epub 2012 Jan 8.
• [16] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [17] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [18] Thalidomide alters c-MYB and PIM-1 signaling in K-562 cells. Pharmacol Res. 2006 Aug;54(2):91-6. doi: 10.1016/j.phrs.2006.02.010. Epub 2006 Mar 8.
• [19] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [20] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [21] ON 01910.Na inhibits growth of diffuse large B-cell lymphoma by cytoplasmic sequestration of sumoylated C-MYB/TRAF6 complex. Transl Res. 2016 Sep;175:129-143.e13. doi: 10.1016/j.trsl.2016.04.001. Epub 2016 Apr 13.
• [22] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [23] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [24] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [25] BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
• [26] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [27] Targeting the beta-catenin/TCF transcriptional complex in the treatment of multiple myeloma. Proc Natl Acad Sci U S A. 2007 May 1;104(18):7516-21. doi: 10.1073/pnas.0610299104. Epub 2007 Apr 23.
• [28] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [29] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [30] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [31] Evaluation of estrogen receptor alpha activation by glyphosate-based herbicide constituents. Food Chem Toxicol. 2017 Oct;108(Pt A):30-42.
• [32] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [33] The effects of 1,4-benzoquinone on c-Myb and topoisomerase II in K-562 cells. Mutat Res. 2008 Oct 14;645(1-2):33-8. doi: 10.1016/j.mrfmmm.2008.08.007. Epub 2008 Aug 20.
• [34] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.
• [35] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.