Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKZCJCB)

DOT Name Homeobox protein MOX-2 (MEOX2)
Synonyms Growth arrest-specific homeobox; Mesenchyme homeobox 2
Gene Name MEOX2
Related Disease
Advanced cancer ( )
Amoebiasis ( )
Cleft palate ( )
Familial Alzheimer disease ( )
Glioblastoma multiforme ( )
Glioma ( )
Intestinal amebiasis ( )
Isolated cleft palate ( )
Laryngeal carcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Myocardial ischemia ( )
Non-small-cell lung cancer ( )
Obstructive sleep apnea ( )
Hepatocellular carcinoma ( )
Alzheimer disease ( )
Neoplasm ( )
Type-1/2 diabetes ( )
UniProt ID
MEOX2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMF
ASQHHRGHHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPEL
GSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYK
SEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRM
KWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSE
HAHL
Function
Mesodermal transcription factor that plays a key role in somitogenesis and somitogenesis and limb muscle differentiation. Required during limb development for normal appendicular muscle formation and for the normal regulation of myogenic genes. May have a regulatory role when quiescent vascular smooth muscle cells reenter the cell cycle. Also acts as a negative regulator of angiogenesis. Activates expression of CDKN1A and CDKN2A in endothelial cells, acting as a regulator of vascular cell proliferation. While it activates CDKN1A in a DNA-dependent manner, it activates CDKN2A in a DNA-independent manner. Together with TCF15, regulates transcription in heart endothelial cells to regulate fatty acid transport across heart endothelial cells.

Molecular Interaction Atlas (MIA) of This DOT

18 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Amoebiasis DISAJWJL Strong Genetic Variation [2]
Cleft palate DIS6G5TF Strong Genetic Variation [3]
Familial Alzheimer disease DISE75U4 Strong Genetic Variation [4]
Glioblastoma multiforme DISK8246 Strong Altered Expression [5]
Glioma DIS5RPEH Strong Altered Expression [5]
Intestinal amebiasis DIS0IHMD Strong Genetic Variation [2]
Isolated cleft palate DISV80CD Strong Genetic Variation [3]
Laryngeal carcinoma DISNHCIV Strong Altered Expression [1]
Lung cancer DISCM4YA Strong Biomarker [5]
Lung carcinoma DISTR26C Strong Biomarker [5]
Myocardial ischemia DISFTVXF Strong Biomarker [6]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [7]
Obstructive sleep apnea DIS0SVD1 Strong Altered Expression [8]
Hepatocellular carcinoma DIS0J828 moderate Biomarker [5]
Alzheimer disease DISF8S70 Limited Genetic Variation [4]
Neoplasm DISZKGEW Limited Biomarker [9]
Type-1/2 diabetes DISIUHAP Limited Biomarker [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 18 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Homeobox protein MOX-2 (MEOX2). [11]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Homeobox protein MOX-2 (MEOX2). [12]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Homeobox protein MOX-2 (MEOX2). [13]
Melphalan DMOLNHF Approved Melphalan decreases the expression of Homeobox protein MOX-2 (MEOX2). [14]
Rofecoxib DM3P5DA Approved Rofecoxib decreases the expression of Homeobox protein MOX-2 (MEOX2). [15]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Homeobox protein MOX-2 (MEOX2). [16]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Homeobox protein MOX-2 (MEOX2). [17]
------------------------------------------------------------------------------------

References

1 Over-expression of MEOX2 promotes apoptosis through inhibiting the PI3K/Akt pathway in laryngeal cancer cells.Neoplasma. 2018 Sep 19;65(5):745-752. doi: 10.4149/neo_2018_171218N824. Epub 2018 Jun 18.
2 Molecular mechanisms underlying gliomas and glioblastoma pathogenesis revealed by bioinformatics analysis of microarray data.Med Oncol. 2017 Sep 26;34(11):182. doi: 10.1007/s12032-017-1043-x.
3 Association of MEOX2 polymorphism with nonsyndromic cleft palate only in a Vietnamese population.Congenit Anom (Kyoto). 2018 Jul;58(4):124-129. doi: 10.1111/cga.12259. Epub 2017 Nov 28.
4 Generation of induced pluripotent stem cell line (ZZUi0013-A) from a 65-year-old patient with a novel MEOX2 gene mutation in Alzheimer's disease.Stem Cell Res. 2019 Jan;34:101366. doi: 10.1016/j.scr.2018.101366. Epub 2018 Dec 27.
5 Prognostic significance of MEOX2 in gliomas.Mod Pathol. 2019 Jun;32(6):774-786. doi: 10.1038/s41379-018-0192-6. Epub 2019 Jan 18.
6 Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
7 Overexpression of MEOX2 and TWIST1 is associated with H3K27me3 levels and determines lung cancer chemoresistance and prognosis.PLoS One. 2014 Dec 2;9(12):e114104. doi: 10.1371/journal.pone.0114104. eCollection 2014.
8 Role of microRNA-130a in the pathogeneses of obstructive sleep apnea hypopnea syndrome-associated pulmonary hypertension by targeting the GAX gene.Medicine (Baltimore). 2017 May;96(20):e6746. doi: 10.1097/MD.0000000000006746.
9 Loss of heterozygosity and SOSTDC1 in adult and pediatric renal tumors.J Exp Clin Cancer Res. 2010 Nov 16;29(1):147. doi: 10.1186/1756-9966-29-147.
10 Mesenchyme Homeobox 2 Enhances Migration of Endothelial Colony Forming Cells Exposed to Intrauterine Diabetes Mellitus.J Cell Physiol. 2017 Jul;232(7):1885-1892. doi: 10.1002/jcp.25734. Epub 2017 Feb 16.
11 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
12 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
13 Bisphenol A effects on gene expression in adipocytes from children: association with metabolic disorders. J Mol Endocrinol. 2015 Jun;54(3):289-303.
14 Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
15 Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
16 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
17 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.