Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLILBUI)

• DOT Name: 7-dehydrocholesterol reductase (DHCR7)
• Synonyms: 7-DHC reductase; EC 1.3.1.21; Delta7-sterol reductase; Sterol Delta(7)-reductase; Sterol reductase SR-2
• Gene Name: DHCR7
• Related Disease: Smith-Lemli-Opitz syndrome
• UniProt ID: DHCR7_HUMAN
• EC Number: 1.3.1.21
• Pfam ID: PF01222
• Sequence:
  MAAKSQPNIPKAKSLDGVTNDRTASQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA
  CDQYSCALTGPVVDIVTGHARLSDIWAKTPPITRKAAQLYTLWVTFQVLLYTSLPDFCHK
  FLPGYVGGIQEGAVTPAGVVNKYQINGLQAWLLTHLLWFANAHLLSWFSPTIIFDNWIPL
  LWCANILGYAVSTFAMVKGYFFPTSARDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFN
  GRPGIVAWTLINLSFAAKQRELHSHVTNAMVLVNVLQAIYVIDFFWNETWYLKTIDICHD
  HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAVGVLLLGLVGYYIFRVANHQKDL
  FRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMGSLAYCL
  ACGGGHLLPYFYIIYMAILLTHRCLRDEHRCASKYGRDWERYTAAVPYRLLPGIF
• Function: 7-dehydrocholesterol reductase of the cholesterol biosynthetic pathway reducing the C7-C8 double bond of cholesta-5,7-dien-3beta-ol (7-dehydrocholesterol/7-DHC) and cholesta-5,7,24-trien-3beta-ol, two intermediates in that pathway.
• Tissue Specificity: Widely expressed. Most abundant in adrenal gland, liver, testis, and brain.
• KEGG Pathway:
  Steroid biosynthesis (hsa00100)
  Metabolic pathways (hsa01100)
• Reactome Pathway:
  Cholesterol biosynthesis via desmosterol (R-HSA-6807047)
  Cholesterol biosynthesis via lathosterol (R-HSA-6807062)
  Activation of gene expression by SREBF (SREBP) (R-HSA-2426168)
• BioCyc Pathway: MetaCyc:HS10588-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Smith-Lemli-Opitz syndrome	DISX9ZUA	Definitive	Autosomal recessive	[1]

This DOT Affected the Regulation of Drug Effects of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
ANW-32821	DMMJOZD	Phase 2	7-dehydrocholesterol reductase (DHCR7) decreases the abundance of ANW-32821.	[37]
Provitamin D3	DM43ABN	Investigative	7-dehydrocholesterol reductase (DHCR7) increases the abundance of Provitamin D3.	[37]

38 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[9]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[11]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[12]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[13]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[14]
Marinol	DM70IK5	Approved	Marinol decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[15]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[16]
Selenium	DM25CGV	Approved	Selenium increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[17]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[18]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[19]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[20]
Simvastatin	DM30SGU	Approved	Simvastatin affects the expression of 7-dehydrocholesterol reductase (DHCR7).	[21]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[22]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[23]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[23]
Fluoxetine	DM3PD2C	Approved	Fluoxetine increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[24]
Hydroxychloroquine	DMSIVND	Approved	Hydroxychloroquine affects the expression of 7-dehydrocholesterol reductase (DHCR7).	[21]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[25]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[26]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[3]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[27]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[28]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[29]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[30]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[31]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[8]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[32]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[33]
PP-242	DM2348V	Investigative	PP-242 decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[34]
Linalool	DMGZQ5P	Investigative	Linalool increases the expression of 7-dehydrocholesterol reductase (DHCR7).	[35]
Ganoderic acid A	DM42EVG	Investigative	Ganoderic acid A decreases the expression of 7-dehydrocholesterol reductase (DHCR7).	[36]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of 7-dehydrocholesterol reductase (DHCR7).	[10]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Characterisation of cisplatin-induced transcriptomics responses in primary mouse hepatocytes, HepG2 cells and mouse embryonic stem cells shows conservation of regulating transcription factor networks. Mutagenesis. 2014 Jan;29(1):17-26.
• [8] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [11] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [12] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [13] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [14] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [15] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [16] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [17] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [18] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [19] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [20] Drug-induced activation of SREBP-controlled lipogenic gene expression in CNS-related cell lines: marked differences between various antipsychotic drugs. BMC Neurosci. 2006 Oct 20;7:69.
• [21] Hydroxychloroquine decreases human MSC-derived osteoblast differentiation and mineralization in vitro. J Cell Mol Med. 2018 Feb;22(2):873-882. doi: 10.1111/jcmm.13373. Epub 2017 Oct 3.
• [22] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [23] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [24] Screening autism-associated environmental factors in differentiating human neural progenitors with fractional factorial design-based transcriptomics. Sci Rep. 2023 Jun 29;13(1):10519. doi: 10.1038/s41598-023-37488-0.
• [25] Integrated transcriptomic and metabolomic analyses to characterize the anti-cancer effects of (-)-epigallocatechin-3-gallate in human colon cancer cells. Toxicol Appl Pharmacol. 2020 Aug 15;401:115100. doi: 10.1016/j.taap.2020.115100. Epub 2020 Jun 6.
• [26] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [27] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [28] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [29] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [30] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [31] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [32] Ochratoxin a lowers mRNA levels of genes encoding for key proteins of liver cell metabolism. Cancer Genomics Proteomics. 2008 Nov-Dec;5(6):319-32.
• [33] Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
• [34] Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
• [35] Linalool is a PPARalpha ligand that reduces plasma TG levels and rewires the hepatic transcriptome and plasma metabolome. J Lipid Res. 2014 Jun;55(6):1098-110.
• [36] Ganoderic Acid A improves high fat diet-induced obesity, lipid accumulation and insulin sensitivity through regulating SREBP pathway. Chem Biol Interact. 2018 Jun 25;290:77-87.
• [37] Development and characterization of a hypomorphic Smith-Lemli-Opitz syndrome mouse model and efficacy of simvastatin therapy. Hum Mol Genet. 2006 Mar 15;15(6):839-51. doi: 10.1093/hmg/ddl003. Epub 2006 Jan 30.