Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLJ11N3)

• DOT Name: Neurobeachin-like protein 1 (NBEAL1)
• Synonyms: Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 16 protein; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 17 protein
• Gene Name: NBEAL1
• Related Disease:
  Advanced cancer
  Alzheimer disease
  Anorexia nervosa cachexia
  Autism spectrum disorder
  Cutaneous larva migrans
  Gastroenteritis
  Gray platelet syndrome
  Helminth infection
  Invasive candidiasis
  Melioidosis
  Myocardial infarction
  Obesity
  Parasitic intestinal disorder
  Prekallikrein deficiency
  Skin and skin-structure infection
  Coronary heart disease
  Factor IX deficiency
  Methicillin-resistant staphylococci infection
  Skin cancer
  Chediak-Higashi syndrome
  Enterovirus infection
  Glioma
  Lewy body dementia
  Stroke
• UniProt ID: NBEL1_HUMAN
• Pfam ID: PF02138 ; PF15787 ; PF16057 ; PF20426 ; PF14844
• Sequence:
  MASRERLFELWMLYCTKKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLP
  DNILQVLRIQLLQCVQKMADGLEEQQQALSILLVKFFIILCRNLSNVEEIGTCSYINYVI
  TMTTLYIQQLKSKKKEKEMADQTCIEEFVIHALAFCESLYDPYRNWRHRISGRILSTVEK
  SRQKYKPASLTVEFVPFFYQCFQESEHLKESLKCCLLHLFGAIVAGGQRNALQAISPATM
  EVLMRVLADCDSWEDGDPEEVGRKAELTLKCLTEVVHILLSSNSDQRQVETSTILENYFK
  LLNSDHSALPNQRRSRQWENRFIALQIKMLNTITAMLDCTDRPVLQAIFLNSNCFEHLIR
  LLQNCKVFQGQLDCLAISTIQALTAVMNKSPAAKEVFKERIGYTHMLEVLKSLGQPPLEL
  LKELMNMAVEGDHTSVGILGISNVQPLLLLIQWLPELQSHDLQIFISDWLKRICCINRQS
  RTTCVNANMGIRIIETLDLHSSLHQTCAENLIAIHGSLGSQSVSSEEIRRLLRLLRVDES
  ESVHPYVTPVTRAILTMARKLSLESALQYFNLSHSMAGISVPPIQKWPGSAFSFSAWFCL
  DQDQLTLGIANKGGKRKQLYSFFTGSGMGFEAFITHSGMLVVAVCTKREYATVMLPDHSF
  CDSLWHNITVVHMPGKRPFGQSFVYIYDNGQQKVSAPLRFPAMNEPFTSCCIGSAGQRTT
  TPPPSQIPDPPFSSPITPHRTSFGGILSSASWGGTIEKSKLITKLISAGTQDSEWGCPTS
  LEGQLGSVIIFYEPLQPPQVKALYLAGPNCLSPWKCQESDMADLPGNILLYYTAKACKNS
  ICLDLSTNCLHGRLTGNKVVNWDIKDIINCIGGLNVLFPLLEQISHFSEGQIPEEKNEST
  VPESVTPVEGDWLVWTSTKASESRLERNLVATFILIVKHFIQRHPINQGNLIHSHGVATL
  GALLQKVPSTLMDVNVLMAVQLLIEQVSLEKNMQLLQQMYQYLLFDFRIWNRGDFPFRIG
  HIQYLSTIIKDSRRVFRKKYGVQFLLDTLRIYYGNGCKYNELSLDDIRTIRTSLYGLIKY
  FLCKGGSHEEIQSIMGYIAATNEEEQLFGILDVLFSLLRTSPTRGQLFLLLFEPGNADIL
  YALLLNQKYSDRLREIIFKIMEQMLKCTNVYERSKQHIRLREVGYSGLGLLLNEALVNTS
  LIKNLTHQIINTDPVINFKDLLSVVYISHRAHINVRVAICRKVLQILQFQPDAAHQISQQ
  VGWQDTLVRLFLKAKFENGNTLHKHSRAVLMKDNDKNMSTEDTKKNSDEKTDEEKITSFA
  SANVSSDQWSLEDRHSLDSNTPLFPEDSSVGELSFKSENQEEFWHSNPSHLSLDLSGIDS
  CEMSDSGSQVPDSLPSTPSPVESTKSFSVHSDRESSITNDMGFSDDFSLLESQERCEEEL
  LQLLTHILNYVMCKGLEKSDDDTWIERGQVFSALSKPGISSELLRPSDEIKLTLLQKMLE
  WAISENREAKTNPVTAENAFRLVLIIQDFLQSEGLVNSNMWTEKLLEDMMLLFDCLSVCY
  SESPVWVKLSQIQIQLLLGFIGRGNLQVCAMASAKLNTLLQTKVIENQDEACYILGKLEH
  VLSQSIKEQTEIYSFLIPLVRTLVSKIYELLFMNLHLPSLPFTNGSSSFFEDFQEYCNSN
  EWQVYIEKYIVPYMKQYEAHTFYDGHENMALYWKDCYEALMVNMHKRDREGGESKLKFQE
  LFVEPFNRKARQENLRYNNMLKQLSSQQLATLRRWKAIQLYLTCERGPWAKRKQNPIHWK
  LANVENYSRMRLKLVPNYNFKTHEEASALRDNLGIQHSQPSSDTLLLEVVKQVKVSDMVE
  DKLDLPEEDITARVNVDEKEEQDQKEKLVLMEDCELITIIDVIPGRLEITTQHIYFYDGS
  IEKEDGVGFDFKWPHSQIREIHLRRYNLRRSALEIFHVDQSNYFLNFKKEVRNKIYSRLL
  SLHSPNSYYGSRSPQELFKASGLTQKWVNREISNFDYLIQINTMAGRTYNDLAQYPVFPW
  ILQDYTSEELDLNNPAVFRDLSKPIGVVNEKNAKAMREKYENFEDPMGTIDKFHYGTHYS
  NSAGVMHYLIRVEPFTTLHIQLQSGRFDCADRQFHSIPATWQALMDNPYDVKELIPEFFY
  FPEFLENQNQFNLGRLQISKELVNDVILPKWAKSAEDFIYKHRKALESEYVSAHLHEWID
  LIFGYKQRGPAAVEALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQTPCQLLKEP
  HPPRLSAEEAVQKPTKIDTSTLNLFQHLPELKSFFIEGISDGIPLLKATIPKNQYRSFMS
  QGSPELLITISMNYVIGTHGWLPYDRNISNYFTFIKDQTVTNPKTQRSINGSFAPGLEIT
  SKLFVVSHDAKLLFSAGYWDNSIQVMSLTKGKIISHIIRHMDIVTCLATDYCGIHLISGS
  RDTTCMIWQITQQGGVPVGLASKPFQILYGHTNEVLSVGISTELDMAVSGSRDGTVIIHT
  IQKGQYMRTLRPPCESSLFLTIPNLAISWEGHIVVYSSTEEKTTLKDKNALHLFSINGKY
  LGSQILKEQVSDICIIGEHIVTGSIQGFLSIRDLHSLNLSINPLAMRLPIHCVCVTKEYS
  HILVGLEDGKLIVVGVGKPAEMRSGQLSRKFWGSSKRLSQISAGETEYNTQDSK
• Tissue Specificity: Highly expressed in brain, kidney, prostate and testis. Weakly expressed in ovary, small intestine, colon and peripheral blood leukocytes. May be correlative to several tumors, such as ovary serous adenocarcinoma and metastasis mammary gland carcinoma breast.

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[2]
Anorexia nervosa cachexia	DISFO5RQ	Strong	Biomarker	[3]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[4]
Cutaneous larva migrans	DISRA9EQ	Strong	Biomarker	[5]
Gastroenteritis	DISXQCG5	Strong	Genetic Variation	[6]
Gray platelet syndrome	DISLOTCW	Strong	Genetic Variation	[7]
Helminth infection	DIS7CGKY	Strong	Biomarker	[5]
Invasive candidiasis	DIS5EI0L	Strong	Biomarker	[8]
Melioidosis	DISB13HR	Strong	Biomarker	[9]
Myocardial infarction	DIS655KI	Strong	Biomarker	[10]
Obesity	DIS47Y1K	Strong	Biomarker	[3]
Parasitic intestinal disorder	DIS1DL0Z	Strong	Biomarker	[11]
Prekallikrein deficiency	DISR1545	Strong	Biomarker	[12]
Skin and skin-structure infection	DIS3F9EY	Strong	Biomarker	[13]
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[14]
Factor IX deficiency	DISHN9SC	moderate	Biomarker	[15]
Methicillin-resistant staphylococci infection	DIS6DRDZ	moderate	Biomarker	[16]
Skin cancer	DISTM18U	moderate	Biomarker	[17]
Chediak-Higashi syndrome	DISPJLLO	Disputed	Genetic Variation	[18]
Enterovirus infection	DISH2UDP	Limited	Genetic Variation	[19]
Glioma	DIS5RPEH	Limited	Altered Expression	[20]
Lewy body dementia	DISAE66J	Limited	Biomarker	[21]
Stroke	DISX6UHX	Limited	Genetic Variation	[22]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Neurobeachin-like protein 1 (NBEAL1).	[23]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Neurobeachin-like protein 1 (NBEAL1).	[24]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Neurobeachin-like protein 1 (NBEAL1).	[25]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Neurobeachin-like protein 1 (NBEAL1).	[26]
Marinol	DM70IK5	Approved	Marinol increases the expression of Neurobeachin-like protein 1 (NBEAL1).	[27]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Neurobeachin-like protein 1 (NBEAL1).	[28]

References

• [1] Human health risks in an old gold mining area with circum-neutral drainage, central Portugal.Environ Geochem Health. 2017 Feb;39(1):43-62. doi: 10.1007/s10653-016-9806-4. Epub 2016 Mar 1.
• [2] Investigations into geriatric psychiatry challenges: AAGP Senior Investigator Award 2000.Am J Geriatr Psychiatry. 2000 Fall;8(4):276-83.
• [3] Evidence for three genetic loci involved in both anorexia nervosa risk and variation of body mass index.Mol Psychiatry. 2017 Feb;22(2):192-201. doi: 10.1038/mp.2016.71. Epub 2016 May 17.
• [4] Examining the relationships of parental stress, family support and family quality of life: A structural equation modeling approach.Res Dev Disabil. 2020 Jan;96:103523. doi: 10.1016/j.ridd.2019.103523. Epub 2019 Nov 27.
• [5] A Unique Case of Cutaneous Larva Migrans Acquired Within the Province of Quebec and Successfully Treated With Topical Ivermectin.J Cutan Med Surg. 2018 May/Jun;22(3):347-348. doi: 10.1177/1203475418755763. Epub 2018 Jan 26.
• [6] An outbreak of Norovirus infections associated with recreational lake water in Western Finland, 2014.Epidemiol Infect. 2018 Apr;146(5):544-550. doi: 10.1017/S0950268818000328. Epub 2018 Feb 26.
• [7] Nbeal2 interacts with Dock7, Sec16a, and Vac14.Blood. 2018 Mar 1;131(9):1000-1011. doi: 10.1182/blood-2017-08-800359. Epub 2017 Nov 29.
• [8] Evaluation of the Candigen enzyme-linked immunosorbent assay for quantitative detection of Candida species antigen.Arch Pathol Lab Med. 2001 Mar;125(3):344-6. doi: 10.5858/2001-125-0344-EOTCEL.
• [9] Soil characteristics influencing the spatial distribution of melioidosis in Far North Queensland, Australia.Epidemiol Infect. 2018 Sep;146(12):1602-1607. doi: 10.1017/S0950268818001188. Epub 2018 Jul 4.
• [10] Whole Exome Sequencing to Identify Genetic Variants Associated with Raised Atherosclerotic Lesions in Young Persons.Sci Rep. 2017 Jun 22;7(1):4091. doi: 10.1038/s41598-017-04433-x.
• [11] Contamination of selected recreational areas in Lublin Province, Eastern Poland, by eggs of Toxocara spp., Ancylostoma spp. and Trichuris spp.Ann Agric Environ Med. 2018 Sep 25;25(3):460-463. doi: 10.26444/aaem/92252. Epub 2018 Aug 8.
• [12] Characterization of a variant prekallikrein, prekallikrein Long Beach, from a family with mixed cross-reacting material-positive and cross-reacting material-negative prekallikrein deficiency.J Clin Invest. 1986 Jul;78(1):170-6. doi: 10.1172/JCI112547.
• [13] Isolation, identification, and pathological effects of beach sand bacterial extract on human skin keratinocytes in vitro.PeerJ. 2018 Jan 12;6:e4245. doi: 10.7717/peerj.4245. eCollection 2018.
• [14] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [15] Characterization of three abnormal factor IX variants (Bm Lake Elsinore, Long Beach, and Los Angeles) of hemophilia-B. Evidence for defects affecting the latent catalytic site.J Clin Invest. 1985 Jan;75(1):76-83. doi: 10.1172/JCI111700.
• [16] Human-associated methicillin-resistant Staphylococcus aureus from a subtropical recreational marine beach.Microb Ecol. 2013 May;65(4):1039-51. doi: 10.1007/s00248-013-0216-1. Epub 2013 Apr 4.
• [17] Preventing Skin Cancer Among Staff and Guests at Seaside Hotels.J Cancer Educ. 2020 Jun;35(3):501-508. doi: 10.1007/s13187-019-01488-4.
• [18] LYST affects lysosome size and quantity, but not trafficking or degradation through autophagy or endocytosis.Traffic. 2014 Dec;15(12):1390-405. doi: 10.1111/tra.12227. Epub 2014 Oct 8.
• [19] Cross-Comparison of Human Wastewater-Associated Molecular Markers in Relation to Fecal Indicator Bacteria and Enteric Viruses in Recreational Beach Waters.Appl Environ Microbiol. 2017 Mar 31;83(8):e00028-17. doi: 10.1128/AEM.00028-17. Print 2017 Apr 15.
• [20] Identification and characterization of NBEAL1, a novel human neurobeachin-like 1 protein gene from fetal brain, which is up regulated in glioma.Brain Res Mol Brain Res. 2004 Jun 18;125(1-2):147-55. doi: 10.1016/j.molbrainres.2004.02.022.
• [21] Most cases with Lewy pathology in a population-based cohort adhere to the Braak progression pattern but 'failure to fit' is highly dependent on staging system applied.Parkinsonism Relat Disord. 2019 Jul;64:124-131. doi: 10.1016/j.parkreldis.2019.03.023. Epub 2019 Mar 28.
• [22] Preemptive volume therapy to prevent hemodynamic changes caused by the beach chair position: hydroxyethyl starch 130/0.4 versus Ringer's acetate-a controlled randomized trial.J Shoulder Elbow Surg. 2018 Dec;27(12):2129-2138. doi: 10.1016/j.jse.2018.08.003. Epub 2018 Oct 12.
• [23] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [24] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [25] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [26] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [27] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [28] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.