Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLRGFSQ)

DOT Name Protein S100-A4 (S100A4)
Synonyms Calvasculin; Metastasin; Placental calcium-binding protein; Protein Mts1; S100 calcium-binding protein A4
Gene Name S100A4
UniProt ID
S10A4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1M31; 2LNK; 2MRD; 2Q91; 3C1V; 3CGA; 3KO0; 3M0W; 3ZWH; 4CFQ; 4CFR; 4ETO; 4HSZ; 5LPU; 6T58; 7PSP; 7PSQ
Pfam ID
PF01023
Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMS
NLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Function
Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9. Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis. Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels. Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes. In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors.
Tissue Specificity Ubiquitously expressed.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Methotrexate DM2TEOL Approved Protein S100-A4 (S100A4) decreases the response to substance of Methotrexate. [47]
Mitomycin DMH0ZJE Approved Protein S100-A4 (S100A4) affects the response to substance of Mitomycin. [48]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Protein S100-A4 (S100A4). [1]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Protein S100-A4 (S100A4). [36]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Protein S100-A4 (S100A4). [38]
------------------------------------------------------------------------------------
45 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Protein S100-A4 (S100A4). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Protein S100-A4 (S100A4). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Protein S100-A4 (S100A4). [4]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Protein S100-A4 (S100A4). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Protein S100-A4 (S100A4). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Protein S100-A4 (S100A4). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Protein S100-A4 (S100A4). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Protein S100-A4 (S100A4). [9]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Protein S100-A4 (S100A4). [10]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Protein S100-A4 (S100A4). [11]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Protein S100-A4 (S100A4). [12]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Protein S100-A4 (S100A4). [13]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Protein S100-A4 (S100A4). [14]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Protein S100-A4 (S100A4). [15]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Protein S100-A4 (S100A4). [16]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Protein S100-A4 (S100A4). [17]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Protein S100-A4 (S100A4). [18]
Folic acid DMEMBJC Approved Folic acid affects the expression of Protein S100-A4 (S100A4). [19]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Protein S100-A4 (S100A4). [20]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Protein S100-A4 (S100A4). [21]
Isotretinoin DM4QTBN Approved Isotretinoin increases the expression of Protein S100-A4 (S100A4). [22]
Ethanol DMDRQZU Approved Ethanol increases the expression of Protein S100-A4 (S100A4). [23]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Protein S100-A4 (S100A4). [24]
Aspirin DM672AH Approved Aspirin decreases the expression of Protein S100-A4 (S100A4). [25]
Paclitaxel DMLB81S Approved Paclitaxel increases the expression of Protein S100-A4 (S100A4). [26]
Capsaicin DMGMF6V Approved Capsaicin increases the expression of Protein S100-A4 (S100A4). [27]
Phenytoin DMNOKBV Approved Phenytoin increases the expression of Protein S100-A4 (S100A4). [28]
Adenosine triphosphate DM79F6G Approved Adenosine triphosphate increases the expression of Protein S100-A4 (S100A4). [29]
Ketamine DMT5HA4 Approved Ketamine increases the expression of Protein S100-A4 (S100A4). [30]
Miglitol DMXBQAM Approved Miglitol decreases the expression of Protein S100-A4 (S100A4). [31]
Ingenol mebutate DMK1CZJ Approved Ingenol mebutate decreases the expression of Protein S100-A4 (S100A4). [32]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Protein S100-A4 (S100A4). [17]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Protein S100-A4 (S100A4). [33]
Tamibarotene DM3G74J Phase 3 Tamibarotene decreases the expression of Protein S100-A4 (S100A4). [34]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Protein S100-A4 (S100A4). [35]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Protein S100-A4 (S100A4). [37]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Protein S100-A4 (S100A4). [39]
Geldanamycin DMS7TC5 Discontinued in Phase 2 Geldanamycin decreases the expression of Protein S100-A4 (S100A4). [40]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Protein S100-A4 (S100A4). [41]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Protein S100-A4 (S100A4). [42]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Protein S100-A4 (S100A4). [43]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Protein S100-A4 (S100A4). [20]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Protein S100-A4 (S100A4). [44]
Bilirubin DMI0V4O Investigative Bilirubin decreases the expression of Protein S100-A4 (S100A4). [45]
Aminohippuric acid DMUN54G Investigative Aminohippuric acid affects the expression of Protein S100-A4 (S100A4). [46]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
4 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
11 Arsenic targets Pin1 and cooperates with retinoic acid to inhibit cancer-driving pathways and tumor-initiating cells. Nat Commun. 2018 Aug 9;9(1):3069. doi: 10.1038/s41467-018-05402-2.
12 Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
13 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
14 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
15 The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
16 Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
17 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
18 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
19 Effects of folate deficiency on gene expression in the apoptosis and cancer pathways in colon cancer cells. Carcinogenesis. 2006 May;27(5):916-24. doi: 10.1093/carcin/bgi312. Epub 2005 Dec 16.
20 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
21 Novel effect of antihelminthic Niclosamide on S100A4-mediated metastatic progression in colon cancer. J Natl Cancer Inst. 2011 Jul 6;103(13):1018-36. doi: 10.1093/jnci/djr190. Epub 2011 Jun 17.
22 Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
23 Comparison of replicative senescence and stress-induced premature senescence combining differential display and low-density DNA arrays. FEBS Lett. 2005 Jul 4;579(17):3651-9. doi: 10.1016/j.febslet.2005.05.056.
24 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
25 Lunasin, a novel seed peptide, sensitizes human breast cancer MDA-MB-231 cells to aspirin-arrested cell cycle and induced apoptosis. Chem Biol Interact. 2010 Jul 30;186(2):127-34. doi: 10.1016/j.cbi.2010.04.027. Epub 2010 May 21.
26 Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
27 Capsaicin promotes a more aggressive gene expression phenotype and invasiveness in null-TRPV1 urothelial cancer cells. Carcinogenesis. 2011 May;32(5):686-94. doi: 10.1093/carcin/bgr025. Epub 2011 Feb 10.
28 Role of phenytoin in wound healing: microarray analysis of early transcriptional responses in human dermal fibroblasts. Biochem Biophys Res Commun. 2004 Feb 13;314(3):661-6. doi: 10.1016/j.bbrc.2003.12.146.
29 Extracellular ATP drives breast cancer cell migration and metastasis via S100A4 production by cancer cells and fibroblasts. Cancer Lett. 2018 Aug 28;430:1-10. doi: 10.1016/j.canlet.2018.04.043. Epub 2018 May 5.
30 Ketamine-induced bladder fibrosis involves epithelial-to-mesenchymal transition mediated by transforming growth factor-1. Am J Physiol Renal Physiol. 2017 Oct 1;313(4):F961-F972. doi: 10.1152/ajprenal.00686.2016. Epub 2017 Mar 22.
31 The -glucosidase inhibitor miglitol decreases glucose fluctuations and inflammatory cytokine gene expression in peripheral leukocytes of Japanese patients with type 2 diabetes mellitus. Metabolism. 2010 Dec;59(12):1816-22. doi: 10.1016/j.metabol.2010.06.006. Epub 2010 Jul 29.
32 Repurposing of ingenol mebutate for treating human colorectal cancer by targeting S100 calcium-binding protein A4 (S100A4). Toxicol Appl Pharmacol. 2022 Aug 15;449:116134. doi: 10.1016/j.taap.2022.116134. Epub 2022 Jun 18.
33 Resveratrol suppresses myofibroblast activity of human buccal mucosal fibroblasts through the epigenetic inhibition of ZEB1 expression. Oncotarget. 2016 Mar 15;7(11):12137-49. doi: 10.18632/oncotarget.7763.
34 Induction of class II major histocompatibility complex expression in human multiple myeloma cells by retinoid. Haematologica. 2007 Jan;92(1):115-20.
35 Atrazine represses S100A4 gene expression and TPA-induced motility in HepG2 cells. Toxicol In Vitro. 2014 Mar;28(2):156-63. doi: 10.1016/j.tiv.2013.10.019. Epub 2013 Nov 6.
36 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
37 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
38 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
39 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
40 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
41 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
42 Genome-wide gene expression profiling of low-dose, long-term exposure of human osteosarcoma cells to bisphenol A and its analogs bisphenols AF and S. Toxicol In Vitro. 2015 Aug;29(5):1060-9.
43 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
44 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
45 Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
46 Cancer-related proteins in serum are altered in workers occupationally exposed to polycyclic aromatic hydrocarbons: a cross-sectional study. Carcinogenesis. 2019 Jul 6;40(6):771-781. doi: 10.1093/carcin/bgz022.
47 Overexpression of S100A4 in human cancer cell lines resistant to methotrexate. BMC Cancer. 2010 Jun 1;10:250. doi: 10.1186/1471-2407-10-250.
48 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.