Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNEQPMZ)

• DOT Name: Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 (LRIT1)
• Synonyms: Leucine-rich repeat-containing protein 21; Photoreceptor-associated LRR superfamily protein; Retina-specific protein PAL
• Gene Name: LRIT1
• Related Disease:
  Cardiac failure
  Classic phenylketonuria
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Congestive heart failure
  Depression
  Infantile myofibromatosis
  Melanocytic nevus
  Melanoma
  Phenylketonuria
  Respiratory failure
  Systemic sclerosis
  Alopecia
  Gingivitis
  Influenza
  Rheumatoid arthritis
  Stroke
  Advanced cancer
  Ankylosing spondylitis
  Kaposi sarcoma
  Type-1/2 diabetes
• UniProt ID: LRIT1_HUMAN
• Pfam ID: PF00041 ; PF07679 ; PF13855
• Sequence:
  MRVALGMLWLLALAWPPQARGFCPSQCSCSLHIMGDGSKARTVVCNDPDMTLPPASIPPD
  TSRLRLERTAIRRVPGEAFRPLGRLEQLWLPYNALSELNALMLRGLRRLRELRLPGNRLA
  AFPWAALRDAPKLRLLDLQANRLSAVPAEAARFLENLTFLDLSSNQLMRLPQELIVSWAH
  LETGIFPPGHHPRRVLGLQDNPWACDCRLYDLVHLLDGWAPNLAFIETELRCASPRSLAG
  VAFSQLELRKCQGPELHPGVASIRSLLGGTALLRCGATGVPGPEMSWRRANGRPLNGTVH
  QEVSSDGTSWTLLGLPAVSHLDSGDYICQAKNFLGASETVISLIVTEPPTSTEHSGSPGA
  LWARTGGGGEAAAYNNKLVARHVPQIPKPAVLATGPSVPSTKEELTLEHFQMDALGELSD
  GRAGPSEARMVRSVKVVGDTYHSVSLVWKAPQAKNTTAFSVLYAVFGQHSMRRVIVQPGK
  TRVTITGLLPKTKYVACVCVQGLVPRKEQCVIFSTNEVVDAENTQQLINVVVISVAIVIA
  LPLTLLVCCSALQKRCRKCFNKDSTEATVTYVNLERLGYSEDGLEELSRHSVSEADRLLS
  ARSSVDFQAFGVKGGRRINEYFC
• Function: Possible role in phototransduction.

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cardiac failure	DISDC067	Strong	Biomarker	[1]
Classic phenylketonuria	DISLU64N	Strong	Biomarker	[2]
Colon cancer	DISVC52G	Strong	Biomarker	[3]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[3]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[4]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[1]
Depression	DIS3XJ69	Strong	Altered Expression	[5]
Infantile myofibromatosis	DISXT8Z7	Strong	Biomarker	[6]
Melanocytic nevus	DISYS32D	Strong	Biomarker	[7]
Melanoma	DIS1RRCY	Strong	Biomarker	[7]
Phenylketonuria	DISCU56J	Strong	Biomarker	[8]
Respiratory failure	DISVMYJO	Strong	Biomarker	[9]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[10]
Alopecia	DIS37HU4	moderate	Biomarker	[11]
Gingivitis	DISC8RMX	moderate	Biomarker	[12]
Influenza	DIS3PNU3	moderate	Biomarker	[13]
Rheumatoid arthritis	DISTSB4J	moderate	Biomarker	[14]
Stroke	DISX6UHX	moderate	Biomarker	[15]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[16]
Ankylosing spondylitis	DISRC6IR	Limited	Biomarker	[14]
Kaposi sarcoma	DISC1H1Z	Limited	Altered Expression	[17]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[18]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 (LRIT1).	[19]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1 (LRIT1).	[20]

References

• [1] Palliative Care in Heart Failure: The PAL-HF Randomized, Controlled Clinical Trial.J Am Coll Cardiol. 2017 Jul 18;70(3):331-341. doi: 10.1016/j.jacc.2017.05.030.
• [2] Long-term safety and efficacy of pegvaliase for the treatment of phenylketonuria in adults: combined phase 2 outcomes through PAL-003 extension study.Orphanet J Rare Dis. 2018 Jul 4;13(1):108. doi: 10.1186/s13023-018-0858-7.
• [3] Biophysical characterization and structural determination of the potent cytotoxic Psathyrella asperospora lectin.Proteins. 2017 May;85(5):969-975. doi: 10.1002/prot.25265. Epub 2017 Mar 7.
• [4] The Feasibility of 18-mm-Diameter Colonic Stents for Obstructive Colorectal Cancers.Oncology. 2017;93 Suppl 1:43-48. doi: 10.1159/000481229. Epub 2017 Dec 20.
• [5] The efficacy of Life Review Therapy combined with Memory Specificity Training (LRT-MST) targeting cancer patients in palliative care: A randomized controlled trial.PLoS One. 2018 May 15;13(5):e0197277. doi: 10.1371/journal.pone.0197277. eCollection 2018.
• [6] Monophasic cellular variant of infantile myofibromatosis. An unusual histopathologic pattern in two siblings.Am J Dermatopathol. 1995 Apr;17(2):131-8. doi: 10.1097/00000372-199504000-00004.
• [7] Monoclonal antibodies selected to discriminate between malignant melanomas and nevocellular nevi.J Invest Dermatol. 1985 Jul;85(1):4-8. doi: 10.1111/1523-1747.ep12274479.
• [8] Pegvaliase for the treatment of phenylketonuria: A pivotal, double-blind randomized discontinuation Phase 3 clinical trial.Mol Genet Metab. 2018 May;124(1):20-26. doi: 10.1016/j.ymgme.2018.03.003. Epub 2018 Mar 18.
• [9] In Vitro Characterization of the Pittsburgh Pediatric Ambulatory Lung.ASAIO J. 2018 Nov/Dec;64(6):806-811. doi: 10.1097/MAT.0000000000000711.
• [10] Physical capacity in performing daily activities is reduced in scleroderma patients with early lung involvement.Clin Respir J. 2017 Jan;11(1):36-42. doi: 10.1111/crj.12299. Epub 2015 May 6.
• [11] Quality of life in patients with limited (1-3) brain metastases undergoing stereotactic or whole brain radiotherapy : Aprospective study of the DEGRO QoL working group.Strahlenther Onkol. 2020 Jan;196(1):48-57. doi: 10.1007/s00066-019-01506-w. Epub 2019 Aug 15.
• [12] Five-year stability of clinical attachment after regenerative treatment of infrabony defects compared to controls.J Clin Periodontol. 2019 Jun;46(6):650-658. doi: 10.1111/jcpe.13105. Epub 2019 May 8.
• [13] Be Aware of Immunogenic But not Protective Antigens: The Actinobacillus pleuropneumoniae PalA as an Example.Protein Pept Lett. 2017;24(11):1059-1065. doi: 10.2174/0929866524666170822121558.
• [14] Vascular endothelial growth factors C and D and their VEGFR-2 and 3 receptors in blood and lymphatic vessels in healthy and arthritic synovium.J Rheumatol. 2002 Jan;29(1):39-45.
• [15] Sleep Duration, Sedentary Behavior, Physical Activity, and Quality of Life after Inpatient Stroke Rehabilitation.J Stroke Cerebrovasc Dis. 2017 Sep;26(9):2004-2012. doi: 10.1016/j.jstrokecerebrovasdis.2017.06.009. Epub 2017 Jun 29.
• [16] Comparison of analgesia, adverse effects, and quality of life in cancer patients during treatment of procedural pain with intravenous morphine, fentanyl nasal spray, and fentanyl buccal tablets.Cancer Manag Res. 2019 Feb 18;11:1587-1600. doi: 10.2147/CMAR.S179012. eCollection 2019.
• [17] CD9 expression on lymphatic vessels in head and neck mucosa.Mod Pathol. 2003 Oct;16(10):1028-34. doi: 10.1097/01.MP.0000089777.58000.B2.
• [18] Friendship with a robot: Children's perception of similarity between a robot's physical and virtual embodiment that supports diabetes self-management.Patient Educ Couns. 2018 Jul;101(7):1248-1255. doi: 10.1016/j.pec.2018.02.008. Epub 2018 Feb 21.
• [19] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [20] Cultured human peripheral blood mononuclear cells alter their gene expression when challenged with endocrine-disrupting chemicals. Toxicology. 2013 Jan 7;303:17-24.