Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOEDR7O)

• DOT Name: Glycophorin-C (GYPC)
• Synonyms: Glycoconnectin; Glycophorin-D; GPD; Glycoprotein beta; PAS-2'; Sialoglycoprotein D; CD antigen CD236
• Gene Name: GYPC
• Related Disease:
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Atrial fibrillation
  Dementia
  Depression
  Epithelial ovarian cancer
  Hepatocellular carcinoma
  Plasmodium vivax malaria
  Schizophrenia
  Southeast Asian ovalocytosis
  Stroke
  Syphilis
  Yellow fever virus infection
  Hereditary elliptocytosis
  Familial atrial fibrillation
  Giant papillary conjunctivitis
  Malaria
  Meningitis
  Vernal keratoconjunctivitis
• UniProt ID: GLPC_HUMAN
• PDB ID: 2EJY
• Sequence:
  MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIV
  VIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGD
  SSRKEYFI
• Function: This protein is a minor sialoglycoprotein in human erythrocyte membranes. The blood group Gerbich antigens and receptors for Plasmodium falciparum merozoites are most likely located within the extracellular domain. Glycophorin-C plays an important role in regulating the stability of red cells.
• Tissue Specificity: Glycophorin-C is expressed in erythrocytes. Glycophorin-D and IsoGPC are ubiquitously expressed.
• KEGG Pathway: Malaria (hsa05144)
• Reactome Pathway: Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Biomarker	[1]
Arteriosclerosis	DISK5QGC	Strong	Altered Expression	[2]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[2]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[3]
Dementia	DISXL1WY	Strong	Biomarker	[1]
Depression	DIS3XJ69	Strong	Biomarker	[4]
Epithelial ovarian cancer	DIS56MH2	Strong	Genetic Variation	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[6]
Plasmodium vivax malaria	DISPU3H9	Strong	Biomarker	[7]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[5]
Southeast Asian ovalocytosis	DISSANVQ	Strong	Biomarker	[8]
Stroke	DISX6UHX	Strong	Biomarker	[1]
Syphilis	DISJ73BS	Strong	Biomarker	[9]
Yellow fever virus infection	DISK0X5T	Strong	Biomarker	[10]
Hereditary elliptocytosis	DISA71F4	Supportive	Autosomal dominant	[11]
Familial atrial fibrillation	DISL4AGF	Limited	Biomarker	[3]
Giant papillary conjunctivitis	DISVLIOB	Limited	Genetic Variation	[12]
Malaria	DISQ9Y50	Limited	Genetic Variation	[13]
Meningitis	DISQABAA	Limited	Biomarker	[14]
Vernal keratoconjunctivitis	DIS36LV6	Limited	Genetic Variation	[12]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Glycophorin-C (GYPC).	[15]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Glycophorin-C (GYPC).	[16]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Glycophorin-C (GYPC).	[17]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Glycophorin-C (GYPC).	[18]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Glycophorin-C (GYPC).	[19]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of Glycophorin-C (GYPC).	[20]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Glycophorin-C (GYPC).	[21]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Glycophorin-C (GYPC).	[22]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Glycophorin-C (GYPC).	[23]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Glycophorin-C (GYPC).	[25]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Glycophorin-C (GYPC).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Glycophorin-C (GYPC).	[27]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Glycophorin-C (GYPC).	[28]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Glycophorin-C (GYPC).	[24]
1,6-hexamethylene diisocyanate	DMLB3RT	Investigative	1,6-hexamethylene diisocyanate increases the methylation of Glycophorin-C (GYPC).	[29]

References

• [1] Late treatment with choline alfoscerate (l-alpha glycerylphosphorylcholine, -GPC) increases hippocampal neurogenesis and provides protection against seizure-induced neuronal death and cognitive impairment.Brain Res. 2017 Jan 1;1654(Pt A):66-76. doi: 10.1016/j.brainres.2016.10.011. Epub 2016 Oct 17.
• [2] The metabonomics study of P-selectin glycoprotein ligand-1 (PSGL-1) deficiency inhibiting the progression of atherosclerosis in LDLR(-/-) mice.Int J Biol Sci. 2018 Jan 1;14(1):36-46. doi: 10.7150/ijbs.23082. eCollection 2018.
• [3] Multi-ethnic genome-wide association study for atrial fibrillation.Nat Genet. 2018 Jun 11;50(9):1225-1233. doi: 10.1038/s41588-018-0133-9.
• [4] Is the Chinese medicinal formula Guipi Decoction () effective as an adjunctive treatment for depression? A meta-analysis of randomized controlled trials.Chin J Integr Med. 2017 May;23(5):386-395. doi: 10.1007/s11655-015-2287-y. Epub 2015 Oct 10.
• [5] Bi-directional Mendelian randomization of epithelial ovarian cancer and schizophrenia and uni-directional Mendelian randomization of schizophrenia on circulating 1- or 2-glycerophosphocholine metabolites.Mol Genet Metab Rep. 2019 Nov 6;21:100539. doi: 10.1016/j.ymgmr.2019.100539. eCollection 2019 Dec.
• [6] Can Glypican3 be diagnostic for early hepatocellular carcinoma among Egyptian patients?.Asian Pac J Cancer Prev. 2013;14(12):7345-9. doi: 10.7314/apjcp.2013.14.12.7345.
• [7] Glycophorin C (CD236R) mediates vivax malaria parasite rosetting to normocytes.Blood. 2014 May 1;123(18):e100-9. doi: 10.1182/blood-2013-12-541698. Epub 2014 Mar 20.
• [8] Membrane compartmentalization in Southeast Asian ovalocytosis red blood cells.Br J Haematol. 2011 Oct;155(1):111-21. doi: 10.1111/j.1365-2141.2011.08805.x. Epub 2011 Jul 27.
• [9] Serodiagnosis of syphilis: antibodies to recombinant Tp0453, Tp92, and Gpd proteins are sensitive and specific indicators of infection by Treponema pallidum.J Clin Microbiol. 2003 Aug;41(8):3668-74. doi: 10.1128/JCM.41.8.3668-3674.2003.
• [10] A recombinant Yellow Fever 17D vaccine expressing Lassa virus glycoproteins.Virology. 2006 Feb 20;345(2):299-304. doi: 10.1016/j.virol.2005.12.001. Epub 2006 Jan 18.
• [11] Molecular basis for elliptocytosis associated with glycophorin C and D deficiency in the Leach phenotype. Blood. 1991 Sep 15;78(6):1603-6.
• [12] Concentration of soluble interleukin-6 receptors in tears of allergic conjunctival disease patients.Jpn J Ophthalmol. 2007 Sep-Oct;51(5):332-337. doi: 10.1007/s10384-007-0461-2. Epub 2007 Oct 5.
• [13] Glycophorin C (Gerbich antigen blood group) and band 3 polymorphisms in two malaria holoendemic regions of Papua New Guinea.Am J Hematol. 2004 Jan;75(1):1-5. doi: 10.1002/ajh.10448.
• [14] Proton NMR metabolic profiling of CSF reveals distinct differentiation of meningitis from negative controls.Clin Chim Acta. 2017 Jun;469:42-52. doi: 10.1016/j.cca.2017.03.015. Epub 2017 Mar 15.
• [15] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [16] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [17] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [18] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [19] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [20] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [21] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [22] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [23] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [24] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [25] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [26] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [27] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [28] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [29] DNA methylation modifies urine biomarker levels in 1,6-hexamethylene diisocyanate exposed workers: a pilot study. Toxicol Lett. 2014 Dec 1;231(2):217-26. doi: 10.1016/j.toxlet.2014.10.024. Epub 2014 Oct 22.