General Information of Drug Off-Target (DOT) (ID: OTOYSQG7)

DOT Name Beta-Ala-His dipeptidase (CNDP1)
Synonyms EC 3.4.13.20; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase
Gene Name CNDP1
Related Disease
Hepatocellular carcinoma ( )
Advanced cancer ( )
Cardiovascular disease ( )
Chronic renal failure ( )
Cyclic hematopoiesis ( )
End-stage renal disease ( )
Glioblastoma multiforme ( )
Glomerulonephritis ( )
Intellectual disability ( )
Kidney failure ( )
Late-onset Parkinson disease ( )
Nephropathy ( )
Obesity ( )
Type-1/2 diabetes ( )
Nervous system disease ( )
Hyperglycemia ( )
UniProt ID
CNDP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3DLJ
EC Number
3.4.13.20
Pfam ID
PF07687 ; PF01546
Sequence
MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIE
SDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGS
DPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAF
RALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAIT
YGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVV
PLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPG
TKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIA
NIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQ
NEKINRWNYIEGTKLFAAFFLEMAQLH
Function Catalyzes the peptide bond hydrolysis in Xaa-His dipeptides, displaying the highest activity toward carnosine (beta-alanyl-L-histidine) and anserine (beta-alanyl-3-methyl-histidine).
Tissue Specificity Found in serum and adult nervous central system. Absent in serum from patients with homocarnosinosis.
KEGG Pathway
Arginine and proline metabolism (hsa00330 )
Histidine metabolism (hsa00340 )
beta-Alanine metabolism (hsa00410 )
Metabolic pathways (hsa01100 )
BioCyc Pathway
MetaCyc:HS07681-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hepatocellular carcinoma DIS0J828 Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Altered Expression [2]
Cardiovascular disease DIS2IQDX Strong Genetic Variation [3]
Chronic renal failure DISGG7K6 Strong Biomarker [4]
Cyclic hematopoiesis DISQQOM4 Strong Biomarker [5]
End-stage renal disease DISXA7GG Strong Biomarker [4]
Glioblastoma multiforme DISK8246 Strong Biomarker [6]
Glomerulonephritis DISPZIQ3 Strong Genetic Variation [7]
Intellectual disability DISMBNXP Strong Biomarker [8]
Kidney failure DISOVQ9P Strong Biomarker [4]
Late-onset Parkinson disease DIS9IOUI Strong Genetic Variation [3]
Nephropathy DISXWP4P Strong Biomarker [9]
Obesity DIS47Y1K Strong Genetic Variation [10]
Type-1/2 diabetes DISIUHAP Strong Biomarker [11]
Nervous system disease DISJ7GGT moderate Altered Expression [2]
Hyperglycemia DIS0BZB5 Limited Altered Expression [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Beta-Ala-His dipeptidase (CNDP1). [13]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Beta-Ala-His dipeptidase (CNDP1). [14]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Beta-Ala-His dipeptidase (CNDP1). [15]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Beta-Ala-His dipeptidase (CNDP1). [16]
------------------------------------------------------------------------------------

References

1 Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
2 Carnosinases, their substrates and diseases.Molecules. 2014 Feb 21;19(2):2299-329. doi: 10.3390/molecules19022299.
3 Relationship between carnosinase gene CNDP1 leucine repeat polymorphism and the clinical outcome of Chinese PD patients.Clin Nephrol. 2010 Nov;74(5):343-5. doi: 10.5414/cnp74343.
4 Monoclonal Antibody RYSK173 Recognizes the Dinuclear Zn Center of Serum Carnosinase 1 (CN-1): Possible Consequences of Zn Binding for CN-1 Recognition by RYSK173.PLoS One. 2016 Jan 22;11(1):e0146831. doi: 10.1371/journal.pone.0146831. eCollection 2016.
5 Analysis of bilirubin UDP-glucuronosyltransferase gene mutations in an unusual Crigler-Najjar syndrome patient.Mol Med Rep. 2012 Sep;6(3):667-9. doi: 10.3892/mmr.2012.950. Epub 2012 Jun 15.
6 Proteins with altered levels in plasma from glioblastoma patients as revealed by iTRAQ-based quantitative proteomic analysis.PLoS One. 2012;7(9):e46153. doi: 10.1371/journal.pone.0046153. Epub 2012 Sep 28.
7 Carnosinase, diabetes mellitus and the potential relevance of carnosinase deficiency.J Inherit Metab Dis. 2018 Jan;41(1):39-47. doi: 10.1007/s10545-017-0099-2. Epub 2017 Oct 13.
8 Serum carnosinase deficiency concomitant with mental retardation.Pediatr Res. 1973 Jul;7(7):601-6. doi: 10.1203/00006450-197307000-00001.
9 Carnosinase concentration, activity, and CNDP1 genotype in patients with type 2 diabetes with and without nephropathy.Amino Acids. 2019 Apr;51(4):611-617. doi: 10.1007/s00726-018-02692-0. Epub 2019 Jan 4.
10 The Combined Effects of Genetic Variation in the CNDP1 and CNDP2 Genes and Dietary Carbohydrate and Carotene Intake on Obesity Risk.J Nutrigenet Nutrigenomics. 2017;10(5-6):146-154. doi: 10.1159/000485798. Epub 2018 Jan 17.
11 Detection of carnosinase-1 in urine of healthy individuals and patients with type 2 diabetes: correlation with albuminuria and renal function.Amino Acids. 2019 Jan;51(1):17-25. doi: 10.1007/s00726-018-2602-y. Epub 2018 Jun 30.
12 N-glycosylation of carnosinase influences protein secretion and enzyme activity: implications for hyperglycemia.Diabetes. 2010 Aug;59(8):1984-90. doi: 10.2337/db09-0868. Epub 2010 May 11.
13 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
14 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
15 Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
16 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.