General Information of Drug Off-Target (DOT) (ID: OTP686K2)

DOT Name Tyrosine-protein kinase Lyn (LYN)
Synonyms EC 2.7.10.2; Lck/Yes-related novel protein tyrosine kinase; V-yes-1 Yamaguchi sarcoma viral related oncogene homolog; p53Lyn; p56Lyn
Gene Name LYN
Related Disease
Autoinflammatory disease, systemic, with vasculitis ( )
UniProt ID
LYN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1W1F; 1WA7; 3A4O; 5XY1; 6NMW; 8WFF
EC Number
2.7.10.2
Pfam ID
PF07714 ; PF00017 ; PF00018
Sequence
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Function
Non-receptor tyrosine-protein kinase that transmits signals from cell surface receptors and plays an important role in the regulation of innate and adaptive immune responses, hematopoiesis, responses to growth factors and cytokines, integrin signaling, but also responses to DNA damage and genotoxic agents. Functions primarily as negative regulator, but can also function as activator, depending on the context. Required for the initiation of the B-cell response, but also for its down-regulation and termination. Plays an important role in the regulation of B-cell differentiation, proliferation, survival and apoptosis, and is important for immune self-tolerance. Acts downstream of several immune receptors, including the B-cell receptor, CD79A, CD79B, CD5, CD19, CD22, FCER1, FCGR2, FCGR1A, TLR2 and TLR4. Plays a role in the inflammatory response to bacterial lipopolysaccharide. Mediates the responses to cytokines and growth factors in hematopoietic progenitors, platelets, erythrocytes, and in mature myeloid cells, such as dendritic cells, neutrophils and eosinophils. Acts downstream of EPOR, KIT, MPL, the chemokine receptor CXCR4, as well as the receptors for IL3, IL5 and CSF2. Plays an important role in integrin signaling. Regulates cell proliferation, survival, differentiation, migration, adhesion, degranulation, and cytokine release. Involved in the regulation of endothelial activation, neutrophil adhesion and transendothelial migration. Down-regulates signaling pathways by phosphorylation of immunoreceptor tyrosine-based inhibitory motifs (ITIM), that then serve as binding sites for phosphatases, such as PTPN6/SHP-1, PTPN11/SHP-2 and INPP5D/SHIP-1, that modulate signaling by dephosphorylation of kinases and their substrates. Phosphorylates LIME1 in response to CD22 activation. Phosphorylates BTK, CBL, CD5, CD19, CD72, CD79A, CD79B, CSF2RB, DOK1, HCLS1, LILRB3/PIR-B, MS4A2/FCER1B, SYK and TEC. Promotes phosphorylation of SIRPA, PTPN6/SHP-1, PTPN11/SHP-2 and INPP5D/SHIP-1. Mediates phosphorylation of the BCR-ABL fusion protein. Required for rapid phosphorylation of FER in response to FCER1 activation. Mediates KIT phosphorylation. Acts as an effector of EPOR (erythropoietin receptor) in controlling KIT expression and may play a role in erythroid differentiation during the switch between proliferation and maturation. Depending on the context, activates or inhibits several signaling cascades. Regulates phosphatidylinositol 3-kinase activity and AKT1 activation. Regulates activation of the MAP kinase signaling cascade, including activation of MAP2K1/MEK1, MAPK1/ERK2, MAPK3/ERK1, MAPK8/JNK1 and MAPK9/JNK2. Mediates activation of STAT5A and/or STAT5B. Phosphorylates LPXN on 'Tyr-72'. Kinase activity facilitates TLR4-TLR6 heterodimerization and signal initiation. Phosphorylates SCIMP on 'Tyr-107'; this enhances binding of SCIMP to TLR4, promoting the phosphorylation of TLR4, and a selective cytokine response to lipopolysaccharide in macrophages. Phosphorylates CLNK. Phosphorylates BCAR1/CAS and NEDD9/HEF1.
Tissue Specificity
Detected in monocytes (at protein level). Detected in placenta, and in fetal brain, lung, liver and kidney. Widely expressed in a variety of organs, tissues, and cell types such as epidermoid, hematopoietic, and neuronal cells. Expressed in primary neuroblastoma tumors.
KEGG Pathway
Chemokine sig.ling pathway (hsa04062 )
NF-kappa B sig.ling pathway (hsa04064 )
Platelet activation (hsa04611 )
B cell receptor sig.ling pathway (hsa04662 )
Fc epsilon RI sig.ling pathway (hsa04664 )
Fc gamma R-mediated phagocytosis (hsa04666 )
Long-term depression (hsa04730 )
Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Epstein-Barr virus infection (hsa05169 )
Viral carcinogenesis (hsa05203 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
Signaling by SCF-KIT (R-HSA-1433557 )
Regulation of KIT signaling (R-HSA-1433559 )
Cell surface interactions at the vascular wall (R-HSA-202733 )
FCGR activation (R-HSA-2029481 )
PECAM1 interactions (R-HSA-210990 )
Fc epsilon receptor (FCERI) signaling (R-HSA-2454202 )
EPH-Ephrin signaling (R-HSA-2682334 )
Role of LAT2/NTAL/LAB on calcium mobilization (R-HSA-2730905 )
FCERI mediated MAPK activation (R-HSA-2871796 )
FCERI mediated Ca+2 mobilization (R-HSA-2871809 )
FCERI mediated NF-kB activation (R-HSA-2871837 )
CD28 co-stimulation (R-HSA-389356 )
CTLA4 inhibitory signaling (R-HSA-389513 )
EPHB-mediated forward signaling (R-HSA-3928662 )
EPHA-mediated growth cone collapse (R-HSA-3928663 )
EPH-ephrin mediated repulsion of cells (R-HSA-3928665 )
Dectin-2 family (R-HSA-5621480 )
CD209 (DC-SIGN) signaling (R-HSA-5621575 )
CD22 mediated BCR regulation (R-HSA-5690714 )
Cyclin D associated events in G1 (R-HSA-69231 )
Platelet Adhesion to exposed collagen (R-HSA-75892 )
Signaling by Erythropoietin (R-HSA-9006335 )
Erythropoietin activates Phosphoinositide-3-kinase (PI3K) (R-HSA-9027276 )
Erythropoietin activates Phospholipase C gamma (PLCG) (R-HSA-9027277 )
Erythropoietin activates STAT5 (R-HSA-9027283 )
Erythropoietin activates RAS (R-HSA-9027284 )
Regulation of signaling by CBL (R-HSA-912631 )
FCGR3A-mediated IL10 synthesis (R-HSA-9664323 )
FCGR3A-mediated phagocytosis (R-HSA-9664422 )
Signaling by phosphorylated juxtamembrane, extracellular and kinase domain KIT mutants (R-HSA-9670439 )
Signaling by CSF3 (G-CSF) (R-HSA-9674555 )
Signaling by CSF1 (M-CSF) in myeloid cells (R-HSA-9680350 )
Inactivation of CSF3 (G-CSF) signaling (R-HSA-9705462 )
Growth hormone receptor signaling (R-HSA-982772 )
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers (R-HSA-983695 )
GPVI-mediated activation cascade (R-HSA-114604 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autoinflammatory disease, systemic, with vasculitis DISSRG9A Strong Autosomal dominant [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Imatinib DM7RJXL Approved Tyrosine-protein kinase Lyn (LYN) decreases the response to substance of Imatinib. [39]
Afimoxifene DMFORDT Phase 2 Tyrosine-protein kinase Lyn (LYN) decreases the response to substance of Afimoxifene. [40]
------------------------------------------------------------------------------------
35 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Tyrosine-protein kinase Lyn (LYN). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Tyrosine-protein kinase Lyn (LYN). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Tyrosine-protein kinase Lyn (LYN). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Tyrosine-protein kinase Lyn (LYN). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Tyrosine-protein kinase Lyn (LYN). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Tyrosine-protein kinase Lyn (LYN). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Tyrosine-protein kinase Lyn (LYN). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Tyrosine-protein kinase Lyn (LYN). [9]
Quercetin DM3NC4M Approved Quercetin increases the expression of Tyrosine-protein kinase Lyn (LYN). [10]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Tyrosine-protein kinase Lyn (LYN). [11]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Tyrosine-protein kinase Lyn (LYN). [12]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Tyrosine-protein kinase Lyn (LYN). [13]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Tyrosine-protein kinase Lyn (LYN). [14]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Tyrosine-protein kinase Lyn (LYN). [13]
Dexamethasone DMMWZET Approved Dexamethasone affects the expression of Tyrosine-protein kinase Lyn (LYN). [16]
Isotretinoin DM4QTBN Approved Isotretinoin increases the expression of Tyrosine-protein kinase Lyn (LYN). [17]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of Tyrosine-protein kinase Lyn (LYN). [18]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Tyrosine-protein kinase Lyn (LYN). [19]
Aspirin DM672AH Approved Aspirin increases the expression of Tyrosine-protein kinase Lyn (LYN). [20]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Tyrosine-protein kinase Lyn (LYN). [21]
Dasatinib DMJV2EK Approved Dasatinib decreases the activity of Tyrosine-protein kinase Lyn (LYN). [22]
Indomethacin DMSC4A7 Approved Indomethacin decreases the expression of Tyrosine-protein kinase Lyn (LYN). [23]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Tyrosine-protein kinase Lyn (LYN). [24]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Tyrosine-protein kinase Lyn (LYN). [13]
Tamibarotene DM3G74J Phase 3 Tamibarotene increases the expression of Tyrosine-protein kinase Lyn (LYN). [25]
Masitinib DMRSNEU Phase 3 Masitinib decreases the activity of Tyrosine-protein kinase Lyn (LYN). [26]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of Tyrosine-protein kinase Lyn (LYN). [27]
PMID25656651-Compound-5 DMAI95U Patented PMID25656651-Compound-5 decreases the activity of Tyrosine-protein kinase Lyn (LYN). [30]
SB-431542 DM0YOXQ Preclinical SB-431542 increases the expression of Tyrosine-protein kinase Lyn (LYN). [31]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Tyrosine-protein kinase Lyn (LYN). [32]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Tyrosine-protein kinase Lyn (LYN). [33]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal decreases the expression of Tyrosine-protein kinase Lyn (LYN). [34]
Aminohippuric acid DMUN54G Investigative Aminohippuric acid affects the expression of Tyrosine-protein kinase Lyn (LYN). [35]
CATECHIN DMY38SB Investigative CATECHIN decreases the expression of Tyrosine-protein kinase Lyn (LYN). [36]
Taurine DMVW7N3 Investigative Taurine decreases the expression of Tyrosine-protein kinase Lyn (LYN). [37]
------------------------------------------------------------------------------------
⏷ Show the Full List of 35 Drug(s)
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Fulvestrant DM0YZC6 Approved Fulvestrant increases the methylation of Tyrosine-protein kinase Lyn (LYN). [15]
Bafetinib DM7586F Phase 2 Bafetinib decreases the phosphorylation of Tyrosine-protein kinase Lyn (LYN). [28]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Tyrosine-protein kinase Lyn (LYN). [29]
Fmet-leu-phe DMQ391A Investigative Fmet-leu-phe increases the phosphorylation of Tyrosine-protein kinase Lyn (LYN). [38]
------------------------------------------------------------------------------------

References

1 Clinical impact of a targeted next-generation sequencing gene panel for autoinflammation and vasculitis. PLoS One. 2017 Jul 27;12(7):e0181874. doi: 10.1371/journal.pone.0181874. eCollection 2017.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
4 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Real-time monitoring of cisplatin-induced cell death. PLoS One. 2011;6(5):e19714. doi: 10.1371/journal.pone.0019714. Epub 2011 May 16.
8 Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
11 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
12 Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
13 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
14 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
15 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
16 Glucocorticoid regulation of human eosinophil gene expression. J Steroid Biochem Mol Biol. 2003 Mar;84(4):441-52. doi: 10.1016/s0960-0760(03)00065-7.
17 Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
18 Analysis of gene expression induced by diethylstilbestrol (DES) in human primitive Mullerian duct cells using microarray. Cancer Lett. 2005 Apr 8;220(2):197-210.
19 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
20 Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
21 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
22 The kinase inhibitor dasatinib induces apoptosis in chronic lymphocytic leukemia cells in vitro with preference for a subgroup of patients with unmutated IgVH genes. Blood. 2008 Aug 15;112(4):1443-52. doi: 10.1182/blood-2007-11-123984. Epub 2008 Jun 12.
23 Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
24 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
25 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
26 Masitinib (AB1010), a potent and selective tyrosine kinase inhibitor targeting KIT. PLoS One. 2009 Sep 30;4(9):e7258. doi: 10.1371/journal.pone.0007258.
27 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
28 Quercetin as a Lyn kinase inhibitor inhibits IgE-mediated allergic conjunctivitis. Food Chem Toxicol. 2020 Jan;135:110924. doi: 10.1016/j.fct.2019.110924. Epub 2019 Oct 28.
29 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
30 AP24534, a pan-BCR-ABL inhibitor for chronic myeloid leukemia, potently inhibits the T315I mutant and overcomes mutation-based resistance. Cancer Cell. 2009 Nov 6;16(5):401-12. doi: 10.1016/j.ccr.2009.09.028.
31 Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
32 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
33 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
34 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
35 Cancer-related proteins in serum are altered in workers occupationally exposed to polycyclic aromatic hydrocarbons: a cross-sectional study. Carcinogenesis. 2019 Jul 6;40(6):771-781. doi: 10.1093/carcin/bgz022.
36 Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.
37 Taurine-responsive genes related to signal transduction as identified by cDNA microarray analyses of HepG2 cells. J Med Food. 2006 Spring;9(1):33-41. doi: 10.1089/jmf.2006.9.33.
38 The anti-inflammatory effect of 2-(4-hydroxy-3-prop-2-enyl-phenyl)-4-prop-2-enyl-phenol by targeting Lyn kinase in human neutrophils. Chem Biol Interact. 2015 Jul 5;236:90-101. doi: 10.1016/j.cbi.2015.05.004. Epub 2015 May 14.
39 Establishment and characterization of a novel imatinib-sensitive chronic myeloid leukemia cell line MYL, and an imatinib-resistant subline MYL-R showing overexpression of Lyn. Eur J Haematol. 2007 May;78(5):417-31. doi: 10.1111/j.1600-0609.2007.00835.x.
40 High-throughput ectopic expression screen for tamoxifen resistance identifies an atypical kinase that blocks autophagy. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2058-63.