Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ01ZAS)

• DOT Name: Glial fibrillary acidic protein (GFAP)
• Synonyms: GFAP
• Gene Name: GFAP
• Related Disease:
  Alexander disease
  Alexander disease type II
• UniProt ID: GFAP_HUMAN
• PDB ID: 6A9P
• Pfam ID: PF00038 ; PF04732
• Sequence:
  MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
  GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
  RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT
  LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT
  QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
  GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
  IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
  IKESKQEHKDVM
• Function: GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
• Tissue Specificity: Expressed in cells lacking fibronectin.
• KEGG Pathway: JAK-STAT sig.ling pathway (hsa04630)
• Reactome Pathway:
  Chaperone Mediated Autophagy (R-HSA-9613829)
  Nuclear signaling by ERBB4 (R-HSA-1251985)

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alexander disease	DISDL1IO	Definitive	Autosomal dominant	[1]
Alexander disease type II	DISY1WQV	Supportive	Autosomal dominant	[2]

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Dopamine	DMPGUCF	Approved	Glial fibrillary acidic protein (GFAP) increases the Mental impairment disorders ADR of Dopamine.	[33]
Penicillin V	DMKVOYF	Approved	Glial fibrillary acidic protein (GFAP) increases the Adverse drug reaction ADR of Penicillin V.	[33]
Framycetin	DMF8DNE	Approved	Glial fibrillary acidic protein (GFAP) increases the Cell-mediated cytotoxicity ADR of Framycetin.	[33]
Dizocilpine	DMMGYXR	Terminated	Glial fibrillary acidic protein (GFAP) increases the Depression ADR of Dizocilpine.	[33]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Glial fibrillary acidic protein (GFAP).	[3]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Glial fibrillary acidic protein (GFAP).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Glial fibrillary acidic protein (GFAP).	[24]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Glial fibrillary acidic protein (GFAP).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Glial fibrillary acidic protein (GFAP).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Glial fibrillary acidic protein (GFAP).	[7]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Glial fibrillary acidic protein (GFAP).	[8]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Glial fibrillary acidic protein (GFAP).	[9]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Glial fibrillary acidic protein (GFAP).	[10]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Glial fibrillary acidic protein (GFAP).	[11]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Glial fibrillary acidic protein (GFAP).	[12]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Glial fibrillary acidic protein (GFAP).	[13]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Glial fibrillary acidic protein (GFAP).	[14]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Glial fibrillary acidic protein (GFAP).	[15]
Cocaine	DMSOX7I	Approved	Cocaine increases the expression of Glial fibrillary acidic protein (GFAP).	[16]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Glial fibrillary acidic protein (GFAP).	[17]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Glial fibrillary acidic protein (GFAP).	[18]
Haloperidol	DM96SE0	Approved	Haloperidol decreases the expression of Glial fibrillary acidic protein (GFAP).	[19]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone decreases the expression of Glial fibrillary acidic protein (GFAP).	[20]
Clotrimazole	DMMFCIH	Approved	Clotrimazole increases the expression of Glial fibrillary acidic protein (GFAP).	[21]
Abacavir	DMMN36E	Approved	Abacavir increases the expression of Glial fibrillary acidic protein (GFAP).	[22]
Amphetamine	DMSZQAK	Approved	Amphetamine increases the expression of Glial fibrillary acidic protein (GFAP).	[16]
Ammonia	DMOEVK6	Approved	Ammonia decreases the expression of Glial fibrillary acidic protein (GFAP).	[23]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Glial fibrillary acidic protein (GFAP).	[7]
SB-431542	DM0YOXQ	Preclinical	SB-431542 increases the expression of Glial fibrillary acidic protein (GFAP).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Glial fibrillary acidic protein (GFAP).	[26]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Glial fibrillary acidic protein (GFAP).	[27]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Glial fibrillary acidic protein (GFAP).	[28]
Forskolin	DM6ITNG	Investigative	Forskolin decreases the expression of Glial fibrillary acidic protein (GFAP).	[29]
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos increases the expression of Glial fibrillary acidic protein (GFAP).	[30]
15-deoxy-Delta(12, 14)-prostaglandin J(2)	DM8VUX3	Investigative	15-deoxy-Delta(12, 14)-prostaglandin J(2) increases the expression of Glial fibrillary acidic protein (GFAP).	[31]
Wogonin	DMGCF51	Investigative	Wogonin increases the expression of Glial fibrillary acidic protein (GFAP).	[32]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Alexander Disease. 2002 Nov 15 [updated 2020 Nov 12]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] miRNA expression profiling in a human stem cell-based model as a tool for developmental neurotoxicity testing. Cell Biol Toxicol. 2013 Aug;29(4):239-57. doi: 10.1007/s10565-013-9250-5. Epub 2013 Aug 1.
• [5] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [6] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [7] Resveratrol enhances the antitumor effects of temozolomide in glioblastoma via ROS-dependent AMPK-TSC-mTOR signaling pathway. CNS Neurosci Ther. 2012 Jul;18(7):536-46. doi: 10.1111/j.1755-5949.2012.00319.x. Epub 2012 Apr 25.
• [8] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [9] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [10] Dickkopf 1 mediates glucocorticoid-induced changes in human neural progenitor cell proliferation and differentiation. Toxicol Sci. 2012 Feb;125(2):488-95. doi: 10.1093/toxsci/kfr304. Epub 2011 Nov 1.
• [11] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [12] Effects of acute ethanol treatment on NCCIT cells and NCCIT cell-derived embryoid bodies (EBs). Toxicol In Vitro. 2010 Sep;24(6):1696-704. doi: 10.1016/j.tiv.2010.05.017. Epub 2010 May 26.
• [13] Aspirin-induced blockade of NF-kappaB activity restrains up-regulation of glial fibrillary acidic protein in human astroglial cells. Biochim Biophys Acta. 2006 Mar;1763(3):282-9. doi: 10.1016/j.bbamcr.2006.01.005. Epub 2006 Feb 21.
• [14] Combination of all-trans retinoic acid and paclitaxel-induced differentiation and apoptosis in human glioblastoma U87MG xenografts in nude mice. Cancer. 2008 Feb 1;112(3):596-607. doi: 10.1002/cncr.23223.
• [15] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [16] Effect of acute and chronic psychostimulant drugs on redox status, AP-1 activation and pro-enkephalin mRNA in the human astrocyte-like U373 MG cells. Neuropharmacology. 2005 Apr;48(5):673-84. doi: 10.1016/j.neuropharm.2004.12.010.
• [17] Capsaicin induces apoptosis and terminal differentiation in human glioma A172 cells. Life Sci. 2008 May 7;82(19-20):997-1003. doi: 10.1016/j.lfs.2008.02.020. Epub 2008 Mar 10.
• [18] Effects of all-trans and 9-cis retinoic acid on differentiating human neural stem cells in vitro. Toxicology. 2023 Mar 15;487:153461. doi: 10.1016/j.tox.2023.153461. Epub 2023 Feb 16.
• [19] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [20] A prominent elevation of glial fibrillary acidic protein in the cerebrospinal fluid during relapse in neuromyelitis optica. Tohoku J Exp Med. 2008 May;215(1):55-9. doi: 10.1620/tjem.215.55.
• [21] Effects of clotrimazole on the growth, morphological characteristics, and cisplatin sensitivity of human glioblastoma cells in vitro. J Neurosurg. 1999 May;90(5):918-27. doi: 10.3171/jns.1999.90.5.0918.
• [22] The antiretroviral nucleoside analogue Abacavir reduces cell growth and promotes differentiation of human medulloblastoma cells. Int J Cancer. 2009 Jul 1;125(1):235-43. doi: 10.1002/ijc.24331.
• [23] Ammonia and proinflammatory cytokines modify expression of genes coding for astrocytic proteins implicated in brain edema in acute liver failure. Metab Brain Dis. 2010 Mar;25(1):17-21.
• [24] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [25] Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
• [26] Roles of ERR and TGF- signaling in stemness enhancement induced by 1 ?M bisphenol A exposure via human neural stem cells. Exp Ther Med. 2022 Feb;23(2):164. doi: 10.3892/etm.2021.11087. Epub 2021 Dec 22.
• [27] Characterization of paraquat-induced miRNA profiling response in hNPCs undergoing proliferation. Int J Mol Sci. 2014 Oct 13;15(10):18422-36. doi: 10.3390/ijms151018422.
• [28] Glyphosate-based herbicide induces long-lasting impairment in neuronal and glial differentiation. Environ Toxicol. 2022 Aug;37(8):2044-2057. doi: 10.1002/tox.23549. Epub 2022 Apr 29.
• [29] Phenolic-rich extract of avocado Persea americana (var. Colinred) peel blunts paraquat/maneb-induced apoptosis through blocking phosphorylation of LRRK2 kinase in human nerve-like cells. Environ Toxicol. 2022 Mar;37(3):660-676. doi: 10.1002/tox.23433. Epub 2021 Dec 12.
• [30] Effects of chlorpyrifos on cell death and cellular phenotypic specification of human neural stem cells. Sci Total Environ. 2019 Sep 15;683:445-454. doi: 10.1016/j.scitotenv.2019.05.270. Epub 2019 May 20.
• [31] The PPARgamma ligands PGJ2 and rosiglitazone show a differential ability to inhibit proliferation and to induce apoptosis and differentiation of human glioblastoma cell lines. Int J Oncol. 2004 Aug;25(2):493-502.
• [32] GSK3/-catenin signaling is correlated with the differentiation of glioma cells induced by wogonin. Toxicol Lett. 2013 Oct 24;222(2):212-23. doi: 10.1016/j.toxlet.2013.07.013. Epub 2013 Jul 19.
• [33] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.