Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSKSU4V)

• DOT Name: Teneurin-1 (TENM1)
• Synonyms: Ten-1; Protein Odd Oz/ten-m homolog 1; Tenascin-M1; Ten-m1; Teneurin transmembrane protein 1
• Gene Name: TENM1
• Related Disease:
  Microphthalmia
  Adenocarcinoma
  Adult glioblastoma
  Breast cancer
  Breast carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Microphthalmia, isolated, with coloboma
  Skin disease
  Thyroid gland papillary carcinoma
  X-linked lymphoproliferative syndrome
  Laryngeal squamous cell carcinoma
  Isolated congenital anosmia
  Advanced cancer
  Anosmia
  Anxiety
  Anxiety disorder
  Cerebral palsy
• UniProt ID: TEN1_HUMAN
• Pfam ID: PF05593 ; PF06484 ; PF15636
• Sequence:
  MEQTDCKPYQPLPKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQ
  SRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVDTETEGAASPDHA
  LRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDV
  QSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTSTQD
  SVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTF
  SRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGELYANG
  VSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRF
  QITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDDTQ
  HSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
  ECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRHGWKGPECDVPEEQCIDPT
  CFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSNHGICVKGECHCSTGWGGVNCETPLP
  VCQEQCSGHGTFLLDAGVCSCDPKWTGSDCSTELCTMECGSHGVCSRGICQCEEGWVGPT
  CEERSCHSHCTEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQN
  GWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYISPLCQGSPDP
  LDLIQQSQTLFSQHTSRLFYDRIKFLIGKDSTHVIPPEVSFDSRRACVIRGQVVAIDGTP
  LVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVILIFDRSPFLPEKRTLWLPWNQFIV
  VEKVTMQRVVSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPIP
  SSFVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGRLTQKWFPAAINLVYT
  FAWNKTDIYGQKVWGLAEALVSVGYEYETCPDFILWEQRTVVLQGFEMDASNLGGWSLNK
  HHILNPQSGIIHKGNGENMFISQQPPVISTIMGNGHQRSVACTNCNGPAHNNKLFAPVAL
  ASGPDGSVYVGDFNFVRRIFPSGNSVSILELSTSPAHKYYLAMDPVSESLYLSDTNTRKV
  YKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITVDRHGFIY
  FVDGTMIRKIDENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLY
  VLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGLLF
  IAETDERKVNRIQQVTTNGEIYIIAGAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPSSL
  AVSPDGTLYVADLGNVRIRTISRNQAHLNDMNIYEIASPADQELYQFTVNGTHLHTLNLI
  TRDYVYNFTYNSEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKR
  VSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLEK
  LTKVELDTSNRENVLMSTNLTATSTIYILKQENTQSTYRVNPDGSLRVTFASGMEIGLSS
  EPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQNKGNVSAFERRLRAHNRNLLSID
  FDHITRTGKIYDDHRKFTLRILYDQTGRPILWSPVSRYNEVNITYSPSGLVTFIQRGTWN
  EKMEYDQSGKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQPDCLLSVTMPSMV
  RHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYTKQARLSE
  VLYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFD
  YSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTK
  IFSANGQVIEVQYEILKAIAYWMTIQYDNVGRMVICDIRVGVDANITRYFYEYDADGQLQ
  TVSVNDKTQWRYSYDLNGNINLLSHGKSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQ
  RGNDIFEYNSNGLLQKAYNKASGWTVQYYYDGLGRRVASKSSLGQHLQFFYADLTNPIRV
  THLYNHTSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSSRGQVIKEILYT
  PYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDVVAGRWTTPNHHIWKQLNLLP
  KPFNLYSFENNYPVGKIQDVAKYTTDIRSWLELFGFQLHNVLPGFPKPELENLELTYELL
  RLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYNDGRCLEGGKQPRFAAVPS
  VFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTHYFIKLGS
  LEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRYGTTVE
  EEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLS
  VEQYLELSDSANNIHFMRQSEIGRR
• Function: Involved in neural development, regulating the establishment of proper connectivity within the nervous system. May function as a cellular signal transducer; [Teneurin C-terminal-associated peptide]: Plays a role in the regulation of neuroplasticity in the limbic system. Mediates a rapid reorganization of actin- and tubulin-based cytoskeleton elements with an increase in dendritic arborization and spine density formation of neurons in the hippocampus and amygdala. Induces BDNF transcription inhibition in neurons. Activates the mitogen-activated protein (MAP) kinase 2 (MEK2) and extracellular signal-regulated kinase (ERK) cascade. Acts also as a bioactive neuroprotective peptide on limbic neurons of the brain and regulates stress-induced behavior: attenuates alkalosis-associated necrotic cell death and the effects of corticotropin-releasing factor (CRF) on c-fos/FOS induction and on the reinstatement of cocaine seeking; [Ten-1 intracellular domain]: Induces gene transcription activation.
• Tissue Specificity: Expressed in fetal brain.

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Microphthalmia	DISGEBES	Definitive	Genetic Variation	[1]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Colon cancer	DISVC52G	Strong	Biomarker	[5]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[5]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[6]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[7]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[8]
Lung adenocarcinoma	DISD51WR	Strong	Genetic Variation	[9]
Lung cancer	DISCM4YA	Strong	Biomarker	[10]
Lung carcinoma	DISTR26C	Strong	Biomarker	[10]
Microphthalmia, isolated, with coloboma	DISLSEUJ	Strong	Genetic Variation	[11]
Skin disease	DISDW8R6	Strong	Biomarker	[12]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Altered Expression	[13]
X-linked lymphoproliferative syndrome	DISA7MJ4	Strong	Genetic Variation	[12]
Laryngeal squamous cell carcinoma	DIS9UUVF	moderate	Biomarker	[14]
Isolated congenital anosmia	DISP2NP8	Supportive	Autosomal dominant	[15]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[4]
Anosmia	DISNRJVL	Limited	X-linked	[16]
Anxiety	DISIJDBA	Limited	Altered Expression	[17]
Anxiety disorder	DISBI2BT	Limited	Altered Expression	[17]
Cerebral palsy	DIS82ODL	Limited	X-linked	[16]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Teneurin-1 (TENM1).	[18]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Teneurin-1 (TENM1).	[19]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Teneurin-1 (TENM1).	[20]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Teneurin-1 (TENM1).	[21]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Teneurin-1 (TENM1).	[22]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Teneurin-1 (TENM1).	[23]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Teneurin-1 (TENM1).	[24]
Enzalutamide	DMGL19D	Approved	Enzalutamide decreases the expression of Teneurin-1 (TENM1).	[25]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Teneurin-1 (TENM1).	[26]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Teneurin-1 (TENM1).	[25]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Teneurin-1 (TENM1).	[24]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Teneurin-1 (TENM1).	[27]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Teneurin-1 (TENM1).	[28]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Teneurin-1 (TENM1).	[30]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Teneurin-1 (TENM1).	[29]

References

• [1] Homozygous null mutation in ODZ3 causes microphthalmia in humans. Genet Med. 2012 Nov;14(11):900-4. doi: 10.1038/gim.2012.71. Epub 2012 Jul 5.
• [2] Overexpression of FZD1 and CAIX are Associated with Invasion, Metastasis, and Poor-Prognosis of the Pancreatic Ductal Adenocarcinoma.Pathol Oncol Res. 2018 Oct;24(4):899-906. doi: 10.1007/s12253-017-0284-5. Epub 2017 Sep 18.
• [3] ODZ1 allows glioblastoma to sustain invasiveness through a Myc-dependent transcriptional upregulation of RhoA.Oncogene. 2017 Mar 23;36(12):1733-1744. doi: 10.1038/onc.2016.341. Epub 2016 Sep 19.
• [4] Randomized trial of Tibetan yoga in patients with breast cancer undergoing chemotherapy.Cancer. 2018 Jan 1;124(1):36-45. doi: 10.1002/cncr.30938. Epub 2017 Sep 20.
• [5] Association between colonic screening, subject characteristics, and stage of colorectal cancer.Am J Gastroenterol. 2005 Nov;100(11):2531-9. doi: 10.1111/j.1572-0241.2005.00319.x.
• [6] Th17 cytokine profiling of colorectal cancer patients with or without enterovirus 71 antigen expression.Cytokine. 2018 Jul;107:35-42. doi: 10.1016/j.cyto.2017.11.012. Epub 2017 Nov 23.
• [7] Hypoxia Can Induce Migration of Glioblastoma Cells Through a Methylation-Dependent Control of ODZ1 Gene Expression.Front Oncol. 2019 Oct 10;9:1036. doi: 10.3389/fonc.2019.01036. eCollection 2019.
• [8] Aldolase B inhibits metastasis through Ten-Eleven Translocation 1 and serves as a prognostic biomarker in hepatocellular carcinoma.Mol Cancer. 2015 Sep 17;14:170. doi: 10.1186/s12943-015-0437-7.
• [9] Identification of dysregulated long non-coding RNAs/microRNAs/mRNAs in TNM I stage lung adenocarcinoma.Oncotarget. 2017 Jun 16;8(31):51703-51718. doi: 10.18632/oncotarget.18512. eCollection 2017 Aug 1.
• [10] Prostaglandin E-Major Urinary Metabolite (PGE-MUM) as a Tumor Marker for Lung Adenocarcinoma.Cancers (Basel). 2019 Jun 3;11(6):768. doi: 10.3390/cancers11060768.
• [11] Confirmation of TENM3 involvement in autosomal recessive colobomatous microphthalmia.Am J Med Genet A. 2016 Jul;170(7):1895-8. doi: 10.1002/ajmg.a.37667. Epub 2016 Apr 22.
• [12] Skin lesions in a boy with X-linked lymphoproliferative disorder: comparison of 5 SH2D1A deletion cases.Pediatrics. 2012 Feb;129(2):e523-8. doi: 10.1542/peds.2011-0870. Epub 2012 Jan 23.
• [13] MicroRNA-486 inhibits cell proliferation, invasion and migration via down-regulating the TENM1 expressions and affecting ERK and Akt signaling pathways and epithelial-to-mesenchymal transition in papillary thyroid carcinoma.Eur Rev Med Pharmacol Sci. 2019 Oct;23(19):8429-8439. doi: 10.26355/eurrev_201910_19155.
• [14] The Expression of MicroRNA-155 in Plasma and Tissue Is Matched in Human Laryngeal Squamous Cell Carcinoma.Yonsei Med J. 2016 Mar;57(2):298-305. doi: 10.3349/ymj.2016.57.2.298.
• [15] A role for TENM1 mutations in congenital general anosmia. Clin Genet. 2016 Sep;90(3):211-9. doi: 10.1111/cge.12782. Epub 2016 May 31.
• [16] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [17] Teneurin proteins possess a carboxy terminal sequence with neuromodulatory activity.Brain Res Mol Brain Res. 2005 Feb 18;133(2):253-65. doi: 10.1016/j.molbrainres.2004.10.019.
• [18] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [19] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [20] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [21] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [22] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [23] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [24] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [25] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [26] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [27] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [28] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [29] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [30] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.