Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSYQN71)

• DOT Name: Calumenin (CALU)
• Synonyms: Crocalbin; IEF SSP 9302
• Gene Name: CALU
• Related Disease:
  Lung adenocarcinoma
  Arteriosclerosis
  Asthma
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  Colon cancer
  Colon carcinoma
  Cystic fibrosis
  Familial hypertrophic cardiomyopathy
  Lung carcinoma
  Atrial fibrillation
  Familial atrial fibrillation
  Filarial disease
  Metastatic malignant neoplasm
  Advanced cancer
  Lung cancer
  Neoplasm
• UniProt ID: CALU_HUMAN
• Pfam ID: PF13202
• Sequence:
  MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKT
  FDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNE
  DGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
  HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEF
  RDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGS
  QATDFGEALVRHDEF
• Function: Involved in regulation of vitamin K-dependent carboxylation of multiple N-terminal glutamate residues. Seems to inhibit gamma-carboxylase GGCX. Binds 7 calcium ions with a low affinity.
• Tissue Specificity: Ubiquitously expressed. Expressed at high levels in heart, placenta and skeletal muscle, at lower levels in lung, kidney and pancreas and at very low levels in brain and liver.
• Reactome Pathway:
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  Post-translational protein phosphorylation (R-HSA-8957275)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DOT

18 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Definitive	Biomarker	[1]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[2]
Asthma	DISW9QNS	Strong	Altered Expression	[3]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Colon cancer	DISVC52G	Strong	Biomarker	[5]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[5]
Cystic fibrosis	DIS2OK1Q	Strong	Genetic Variation	[6]
Familial hypertrophic cardiomyopathy	DISQ89HN	Strong	Altered Expression	[3]
Lung carcinoma	DISTR26C	Strong	Biomarker	[7]
Atrial fibrillation	DIS15W6U	moderate	Biomarker	[8]
Familial atrial fibrillation	DISL4AGF	moderate	Biomarker	[8]
Filarial disease	DISWBRRN	moderate	Biomarker	[9]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[10]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[11]
Lung cancer	DISCM4YA	Limited	Biomarker	[7]
Neoplasm	DISZKGEW	Limited	Biomarker	[12]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Warfarin	DMJYCVW	Approved	Calumenin (CALU) affects the response to substance of Warfarin.	[34]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Calumenin (CALU).	[13]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Calumenin (CALU).	[14]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Calumenin (CALU).	[15]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Calumenin (CALU).	[16]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Calumenin (CALU).	[17]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Calumenin (CALU).	[18]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Calumenin (CALU).	[19]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Calumenin (CALU).	[20]
Selenium	DM25CGV	Approved	Selenium increases the expression of Calumenin (CALU).	[21]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Calumenin (CALU).	[22]
Benzatropine	DMF7EXL	Approved	Benzatropine decreases the expression of Calumenin (CALU).	[22]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Calumenin (CALU).	[23]
Phenol	DM1QSM3	Phase 2/3	Phenol decreases the expression of Calumenin (CALU).	[25]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Calumenin (CALU).	[21]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Calumenin (CALU).	[16]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Calumenin (CALU).	[27]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Calumenin (CALU).	[28]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Calumenin (CALU).	[29]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Calumenin (CALU).	[30]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Calumenin (CALU).	[31]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Calumenin (CALU).	[32]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Calumenin (CALU).	[33]
1,4-Dithiothreitol	DMIFOXE	Investigative	1,4-Dithiothreitol increases the expression of Calumenin (CALU).	[27]

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Resveratrol	DM3RWXL	Phase 3	Resveratrol affects the secretion of Calumenin (CALU).	[24]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the secretion of Calumenin (CALU).	[24]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Calumenin (CALU).	[26]

References

• [1] c-erbB-2/p185-directed therapy in human lung adenocarcinoma.Ann Thorac Surg. 1996 Nov;62(5):1454-9. doi: 10.1016/0003-4975(96)00630-3.
• [2] CALU A29809G polymorphism in coronary atherothrombosis: Implications for coronary calcification and prognosis.Ann Med. 2010 Sep;42(6):439-46. doi: 10.3109/07853890.2010.499131.
• [3] Profiling of healthy and asthmatic airway smooth muscle cells following interleukin-1 treatment: a novel role for CCL20 in chronic mucus hypersecretion.Eur Respir J. 2018 Aug 9;52(2):1800310. doi: 10.1183/13993003.00310-2018. Print 2018 Aug.
• [4] Development and Evaluation of Antibody Proteomics Technology for Rapid and Comprehensive Identification of Potential Biomarkers and Therapeutic Targets.Biol Pharm Bull. 2018;41(5):663-669. doi: 10.1248/bpb.b17-01041.
• [5] Proteome profiling of cancer-associated fibroblasts identifies novel proinflammatory signatures and prognostic markers for colorectal cancer.Clin Cancer Res. 2013 Nov 1;19(21):6006-19. doi: 10.1158/1078-0432.CCR-13-1130. Epub 2013 Sep 11.
• [6] Biophysical characterisation of calumenin as a charged F508del-CFTR folding modulator.PLoS One. 2014 Aug 13;9(8):e104970. doi: 10.1371/journal.pone.0104970. eCollection 2014.
• [7] Evaluation of peroxidative stress of cancer cells in vitro by real-time quantification of volatile aldehydes in culture headspace.Rapid Commun Mass Spectrom. 2017 Aug 30;31(16):1344-1352. doi: 10.1002/rcm.7911.
• [8] Biobank-driven genomic discovery yields new insight into atrial fibrillation biology.Nat Genet. 2018 Sep;50(9):1234-1239. doi: 10.1038/s41588-018-0171-3. Epub 2018 Jul 30.
• [9] Novel Findings of Anti-Filarial Drug Target and Structure-Based Virtual Screening for Drug Discovery.Int J Mol Sci. 2018 Nov 13;19(11):3579. doi: 10.3390/ijms19113579.
• [10] Calumenin and fibulin-1 on tumor metastasis: Implications for pharmacology.Pharmacol Res. 2015 Sep;99:11-5. doi: 10.1016/j.phrs.2015.05.001. Epub 2015 May 12.
• [11] Proteomic characterization of early lung response to breast cancer metastasis in mice.Exp Mol Pathol. 2019 Apr;107:129-140. doi: 10.1016/j.yexmp.2019.02.001. Epub 2019 Feb 11.
• [12] RETRACTED: Antitumor activity of bortezomib in human cancer cells with acquired resistance to anti-epidermal growth factor receptor tyrosine kinase inhibitors.Lung Cancer. 2011 Mar;71(3):283-90. doi: 10.1016/j.lungcan.2010.06.005.
• [13] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [14] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [15] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [16] Gene expression changes associated with cytotoxicity identified using cDNA arrays. Funct Integr Genomics. 2000 Sep;1(2):114-26.
• [17] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [18] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [19] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [20] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [21] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [22] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [23] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [24] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
• [25] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [26] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [27] Proteomic signatures in thapsigargin-treated hepatoma cells. Chem Res Toxicol. 2011 Aug 15;24(8):1215-22. doi: 10.1021/tx200109y. Epub 2011 Jul 1.
• [28] Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
• [29] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [30] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [31] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [32] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [33] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [34] Genetic determinants of variability in warfarin response after the dose-titration phase. Pharmacogenet Genomics. 2016 Nov;26(11):510-516. doi: 10.1097/FPC.0000000000000244.