Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTDFM1O)

• DOT Name: Amine oxidase B (MAOB)
• Synonyms: EC 1.4.3.21; EC 1.4.3.4; Monoamine oxidase type B; MAO-B
• Gene Name: MAOB
• UniProt ID: AOFB_HUMAN
• PDB ID: 1GOS ; 1OJ9 ; 1OJA ; 1OJC ; 1OJD ; 1S2Q ; 1S2Y ; 1S3B ; 1S3E ; 2BK3 ; 2BK4 ; 2BK5 ; 2BYB ; 2C64 ; 2C65 ; 2C66 ; 2C67 ; 2C70 ; 2C72 ; 2C73 ; 2C75 ; 2C76 ; 2V5Z ; 2V60 ; 2V61 ; 2VRL ; 2VRM ; 2VZ2 ; 2XCG ; 2XFN ; 2XFO ; 2XFP ; 2XFQ ; 2XFU ; 3PO7 ; 3ZYX ; 4A79 ; 4A7A ; 4CRT ; 5MRL ; 6FVZ ; 6FW0 ; 6FWC ; 6RKB ; 6RKP ; 6RLE ; 6YT2 ; 7B0V ; 7B0Z ; 7P4F ; 7P4H ; 7ZW3
• EC Number: 1.4.3.21; 1.4.3.4
• Pfam ID: PF01593
• Sequence:
  MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
  VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
  TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
  SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
  TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
  YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
  LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
  IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
  FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
• Function: Catalyzes the oxidative deamination of primary and some secondary amines such as neurotransmitters, and exogenous amines including the tertiary amine, neurotoxin 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP), with concomitant reduction of oxygen to hydrogen peroxide and participates in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. Preferentially degrades benzylamine and phenylethylamine.
• KEGG Pathway:
  Glycine, serine and threonine metabolism (hsa00260)
  Arginine and proline metabolism (hsa00330)
  Histidine metabolism (hsa00340)
  Tyrosine metabolism (hsa00350)
  Phenylalanine metabolism (hsa00360)
  Tryptophan metabolism (hsa00380)
  Drug metabolism - cytochrome P450 (hsa00982)
  Metabolic pathways (hsa01100)
  Serotonergic sy.pse (hsa04726)
  Dopaminergic sy.pse (hsa04728)
  Parkinson disease (hsa05012)
  Cocaine addiction (hsa05030)
  Amphetamine addiction (hsa05031)
  Alcoholism (hsa05034)
• Reactome Pathway: Biogenic amines are oxidatively deaminated to aldehydes by MAOA and MAOB (R-HSA-141333)
• BioCyc Pathway: MetaCyc:HS00966-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Biotransformations of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Dopamine	DMPGUCF	Approved	Amine oxidase B (MAOB) decreases the amination of Dopamine.	[27]
TRYPTAMINE	DMAFPHB	Phase 3	Amine oxidase B (MAOB) decreases the amination of TRYPTAMINE.	[29]
Serotonin	DMOFCRY	Investigative	Amine oxidase B (MAOB) decreases the amination of Serotonin.	[27]
1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine	DMPWB8G	Investigative	Amine oxidase B (MAOB) increases the oxidation of 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine.	[12]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Amphetamine	DMSZQAK	Approved	Amine oxidase B (MAOB) decreases the response to substance of Amphetamine.	[28]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Amine oxidase B (MAOB).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Amine oxidase B (MAOB).	[20]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Amine oxidase B (MAOB).	[23]

33 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Amine oxidase B (MAOB).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Amine oxidase B (MAOB).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Amine oxidase B (MAOB).	[4]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Amine oxidase B (MAOB).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Amine oxidase B (MAOB).	[6]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Amine oxidase B (MAOB).	[7]
Carbamazepine	DMZOLBI	Approved	Carbamazepine increases the expression of Amine oxidase B (MAOB).	[8]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Amine oxidase B (MAOB).	[9]
Phenobarbital	DMXZOCG	Approved	Phenobarbital decreases the expression of Amine oxidase B (MAOB).	[10]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Amine oxidase B (MAOB).	[11]
Menadione	DMSJDTY	Approved	Menadione decreases the activity of Amine oxidase B (MAOB).	[12]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the activity of Amine oxidase B (MAOB).	[13]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the activity of Amine oxidase B (MAOB).	[13]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Amine oxidase B (MAOB).	[14]
Selegiline	DM6034S	Approved	Selegiline decreases the activity of Amine oxidase B (MAOB).	[15]
Methylene blue	DMJAPE7	Approved	Methylene blue decreases the activity of Amine oxidase B (MAOB).	[12]
Benzyl benzoate	DMDPYI5	Approved	Benzyl benzoate decreases the activity of Amine oxidase B (MAOB).	[16]
Linezolid	DMGFPU2	Approved	Linezolid decreases the activity of Amine oxidase B (MAOB).	[17]
Pargyline	DMM0HR1	Approved	Pargyline decreases the activity of Amine oxidase B (MAOB).	[16]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Amine oxidase B (MAOB).	[18]
3,4-Dihydroxycinnamic Acid	DMVZL26	Phase 4	3,4-Dihydroxycinnamic Acid decreases the activity of Amine oxidase B (MAOB).	[16]
Fucoxanthin	DMPQFTA	Phase 2	Fucoxanthin decreases the activity of Amine oxidase B (MAOB).	[19]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Amine oxidase B (MAOB).	[21]
Benzylcinnamate	DMD7Z3H	Patented	Benzylcinnamate decreases the activity of Amine oxidase B (MAOB).	[16]
Lazabemide	DMCULK7	Patented	Lazabemide decreases the activity of Amine oxidase B (MAOB).	[22]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Amine oxidase B (MAOB).	[24]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid affects the expression of Amine oxidase B (MAOB).	[25]
Chlorogenic acid	DM2Y3P4	Investigative	Chlorogenic acid decreases the activity of Amine oxidase B (MAOB).	[16]
ROSMARINIC ACID	DMQ6SJT	Investigative	ROSMARINIC ACID decreases the activity of Amine oxidase B (MAOB).	[16]
NORHARMANE	DMKYQWG	Investigative	NORHARMANE decreases the activity of Amine oxidase B (MAOB).	[12]
1,2,3,4-tetrahydroisoquinoline	DMZGCEQ	Investigative	1,2,3,4-tetrahydroisoquinoline decreases the activity of Amine oxidase B (MAOB).	[26]
5-Nitroindazole	DMH7SIX	Investigative	5-Nitroindazole decreases the activity of Amine oxidase B (MAOB).	[12]
2-Methyl-beta-carboline-2-ium iodide	DMQBF7J	Investigative	2-Methyl-beta-carboline-2-ium iodide decreases the activity of Amine oxidase B (MAOB).	[12]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [7] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [8] Transcriptional profiling of genes induced in the livers of patients treated with carbamazepine. Clin Pharmacol Ther. 2006 Nov;80(5):440-456.
• [9] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [10] Xenobiotic CAR activators induce Dlk1-Dio3 locus noncoding RNA expression in mouse liver. Toxicol Sci. 2017 Aug 1;158(2):367-378.
• [11] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [12] Inhibition of the bioactivation of the neurotoxin MPTP by antioxidants, redox agents and monoamine oxidase inhibitors. Food Chem Toxicol. 2011 Aug;49(8):1773-81.
• [13] Molecular Insights into Human Monoamine Oxidase B Inhibition by the Glitazone Anti-Diabetes Drugs. ACS Med Chem Lett. 2011 Oct 15;3(1):39-42.
• [14] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [15] Chromone, a privileged scaffold for the development of monoamine oxidase inhibitors. J Med Chem. 2011 Jul 28;54(14):5165-73.
• [16] Combining initro and in silico approaches to evaluate the multifunctional profile of rosmarinic acid from Blechnum brasiliense on targets related to neurodegeneration. Chem Biol Interact. 2016 Jul 25;254:135-45.
• [17] Nonclinical Evaluation of Antibacterial Oxazolidinones Contezolid and Contezolid Acefosamil with Low Serotonergic Neurotoxicity. Chem Res Toxicol. 2021 May 17;34(5):1348-1354. doi: 10.1021/acs.chemrestox.0c00524. Epub 2021 Apr 29.
• [18] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [19] Characterizing fucoxanthin as a selective dopamine D(3)/D(4) receptor agonist: Relevance to Parkinson's disease. Chem Biol Interact. 2019 Sep 1;310:108757. doi: 10.1016/j.cbi.2019.108757. Epub 2019 Jul 16.
• [20] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [21] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [22] Safety study of lazabemide (Ro19-6327), a new MAO-B inhibitor, on cardiac arrhythmias and blood pressure of patients with Parkinson's disease. Clin Neuropharmacol. 1999 Nov-Dec;22(6):340-6.
• [23] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [24] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [25] Identification of molecular signatures predicting the carcinogenicity of polycyclic aromatic hydrocarbons (PAHs). Toxicol Lett. 2012 Jul 7;212(1):18-28. doi: 10.1016/j.toxlet.2012.04.013. Epub 2012 May 1.
• [26] Inhibition of monoamine oxidases A and B by simple isoquinoline alkaloids: racemic and optically active 1,2,3,4-tetrahydro-, 3,4-dihydro-, and fully aromatic isoquinolines. J Med Chem. 1990 Jan;33(1):147-52. doi: 10.1021/jm00163a025.
• [27] Inhibition potential of 3,4-methylenedioxymethamphetamine (MDMA) and its metabolites on the in vitro monoamine oxidase (MAO)-catalyzed deamination of the neurotransmitters serotonin and dopamine. Toxicol Lett. 2016 Jan 22;243:48-55.
• [28] Differential effects of chronic amphetamine and baclofen administration on cAMP levels and phosphorylation of CREB in distinct brain regions of wild type and monoamine oxidase B-deficient mice. Synapse. 2006 Dec 15;60(8):573-84. doi: 10.1002/syn.20334.
• [29] Evidence for new light-independent pathways for generation of the endogenous aryl hydrocarbon receptor agonist FICZ. Chem Res Toxicol. 2016 Jan 19;29(1):75-86.