Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTKPTUP)

• DOT Name: Prefoldin subunit 5 (PFDN5)
• Synonyms: Myc modulator 1; c-Myc-binding protein Mm-1
• Gene Name: PFDN5
• Related Disease:
  Advanced cancer
  Al amyloidosis
  Alzheimer disease
  Pancreatic cancer
  Systemic lupus erythematosus
  Triple negative breast cancer
  Von Willebrand disease 1
  Adult lymphoma
  Ankylosing spondylitis
  leukaemia
  Leukemia
  Lymphoma
  Neoplasm
  Pediatric lymphoma
  Uveitis
• UniProt ID: PFD5_HUMAN
• PDB ID: 6NR8; 6NR9; 6NRB; 6NRC; 6NRD; 7WU7
• Pfam ID: PF02996
• Sequence:
  MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGK
  ELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPA
  LQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA
• Function: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC.
• Tissue Specificity: Highly expressed in pancreas and skeletal muscle and moderately in other tissues.
• Reactome Pathway: Prefoldin mediated transfer of substrate to CCT/TriC (R-HSA-389957)

Molecular Interaction Atlas (MIA) of This DOT

15 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Al amyloidosis	DISMHVSL	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[3]
Pancreatic cancer	DISJC981	Strong	Biomarker	[4]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[5]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[6]
Von Willebrand disease 1	DISUGLZA	Strong	Biomarker	[7]
Adult lymphoma	DISK8IZR	Limited	Biomarker	[8]
Ankylosing spondylitis	DISRC6IR	Limited	Biomarker	[9]
leukaemia	DISS7D1V	Limited	Biomarker	[8]
Leukemia	DISNAKFL	Limited	Biomarker	[8]
Lymphoma	DISN6V4S	Limited	Biomarker	[8]
Neoplasm	DISZKGEW	Limited	Biomarker	[10]
Pediatric lymphoma	DIS51BK2	Limited	Biomarker	[8]
Uveitis	DISV0RYS	Limited	Biomarker	[9]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Prefoldin subunit 5 (PFDN5).	[11]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Prefoldin subunit 5 (PFDN5).	[12]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Prefoldin subunit 5 (PFDN5).	[13]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Prefoldin subunit 5 (PFDN5).	[14]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Prefoldin subunit 5 (PFDN5).	[16]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Prefoldin subunit 5 (PFDN5).	[17]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Prefoldin subunit 5 (PFDN5).	[18]
Acocantherin	DM7JT24	Approved	Acocantherin affects the expression of Prefoldin subunit 5 (PFDN5).	[19]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Prefoldin subunit 5 (PFDN5).	[20]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Prefoldin subunit 5 (PFDN5).	[22]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Prefoldin subunit 5 (PFDN5).	[23]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Prefoldin subunit 5 (PFDN5).	[24]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Prefoldin subunit 5 (PFDN5).	[25]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Prefoldin subunit 5 (PFDN5).	[26]
biochanin A	DM0HPWY	Investigative	biochanin A decreases the expression of Prefoldin subunit 5 (PFDN5).	[27]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Prefoldin subunit 5 (PFDN5).	[15]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Prefoldin subunit 5 (PFDN5).	[21]

References

• [1] Common mechanisms of onset of cancer and neurodegenerative diseases.Biol Pharm Bull. 2015;38(6):795-808. doi: 10.1248/bpb.b15-00125.
• [2] Hyperdiploidy is less frequent in AL amyloidosis compared with monoclonal gammopathy of undetermined significance and inversely associated with translocation t(11;14).Blood. 2011 Apr 7;117(14):3809-15. doi: 10.1182/blood-2010-02-268987. Epub 2011 Feb 10.
• [3] Changes in the expression of prefoldin subunit 5 depending on synaptic plasticity in the mouse hippocampus.Neurosci Lett. 2019 Nov 1;712:134484. doi: 10.1016/j.neulet.2019.134484. Epub 2019 Sep 7.
• [4] Gene expression analysis of pancreatic cell lines reveals genes overexpressed in pancreatic cancer.Pancreatology. 2005;5(4-5):370-9. doi: 10.1159/000086537. Epub 2005 Jun 23.
• [5] Gene profiling involved in immature CD4+ T lymphocyte responsible for systemic lupus erythematosus.Mol Immunol. 2006 Mar;43(9):1497-507. doi: 10.1016/j.molimm.2005.07.039. Epub 2005 Sep 6.
• [6] SPAG5 upregulation contributes to enhanced c-MYC transcriptional activity via interaction with c-MYC binding protein in triple-negative breast cancer.J Hematol Oncol. 2019 Feb 8;12(1):14. doi: 10.1186/s13045-019-0700-2.
• [7] Severe postpartum haemorrhage as first presenting symptom of an inherited bleeding disorder.Haemophilia. 2019 Nov;25(6):1051-1058. doi: 10.1111/hae.13846. Epub 2019 Oct 3.
• [8] MM-1, a c-Myc-binding protein, is a candidate for a tumor suppressor in leukemia/lymphoma and tongue cancer.J Biol Chem. 2001 Nov 30;276(48):45137-44. doi: 10.1074/jbc.M106127200. Epub 2001 Sep 20.
• [9] Prefoldin 5 and Anti-prefoldin 5 Antibodies as Biomarkers for Uveitis in Ankylosing Spondylitis.Front Immunol. 2019 Mar 5;10:384. doi: 10.3389/fimmu.2019.00384. eCollection 2019.
• [10] Differential gene expression profiles and identification of the genes relevant to clinicopathologic factors in colorectal cancer selected by cDNA array method in combination with principal component analysis.Int J Oncol. 2003 Jul;23(1):49-59.
• [11] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [12] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [13] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [14] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [15] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [16] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [17] DNA microarray analysis of changes in gene expression induced by 1,25-dihydroxyvitamin D3 in human promyelocytic leukemia HL-60 cells. Biomed Res. 2006 Jun;27(3):99-109. doi: 10.2220/biomedres.27.99.
• [18] The use of genomics technology to investigate gene expression changes in cultured human liver cells. Toxicol In Vitro. 2001 Aug-Oct;15(4-5):399-405. doi: 10.1016/s0887-2333(01)00043-1.
• [19] Proteomics analysis of the proliferative effect of low-dose ouabain on human endothelial cells. Biol Pharm Bull. 2007 Feb;30(2):247-53. doi: 10.1248/bpb.30.247.
• [20] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [21] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [22] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [23] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [24] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [25] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [26] Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
• [27] Mechanisms of the growth inhibitory effects of the isoflavonoid biochanin A on LNCaP cells and xenografts. Prostate. 2002 Aug 1;52(3):201-12.