Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU0UAZS)

• DOT Name: Semaphorin-6D (SEMA6D)
• Gene Name: SEMA6D
• Related Disease:
  Attention deficit hyperactivity disorder
  Cryohydrocytosis
  Drug dependence
  Major depressive disorder
  Schizophrenia
  Stomach cancer
  Substance abuse
  Substance dependence
  Bone osteosarcoma
  Chronic renal failure
  End-stage renal disease
  Inflammatory bowel disease
  Osteosarcoma
  Ulcerative colitis
  Advanced cancer
  Complex neurodevelopmental disorder
  Lung carcinoma
  Malignant pleural mesothelioma
  Neoplasm
• UniProt ID: SEM6D_HUMAN
• Pfam ID: PF01437 ; PF01403
• Sequence:
  MRVFLLCAYILLLMVSQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQ
  LMLKIRDTLYIAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHN
  FIKVFVPRNDEMVFVCGTNAFNPMCRYYRLSTLEYDGEEISGLARCPFDARQTNVALFAD
  GKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREI
  AVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSI
  TDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVPED
  KVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRVRYR
  LTAISVDHSAGPYQNYTVIFVGSEAGMVLKVLAKTSPFSLNDSVLLEEIEAYNHAKCSAE
  NEEDKKVISLQLDKDHHALYVAFSSCIIRIPLSRCERYGSCKKSCIASRDPYCGWLSQGS
  CGRVTPGMLAEGYEQDTEFGNTAHLGDCHEILPTSTTPDYKIFGGPTSDMEVSSSSVTTM
  ASIPEITPKVIDTWRPKLTSSRKFVVQDDPNTSDFTDPLSGIPKGVRWEVQSGESNQMVH
  MNVLITCVFAAFVLGAFIAGVAVYCYRDMFVRKNRKIHKDAESAQSCTDSSGSFAKLNGL
  FDSPVKEYQQNIDSPKLYSNLLTSRKELPPNGDTKSMVMDHRGQPPELAALPTPESTPVL
  HQKTLQAMKSHSEKAHGHGASRKETPQFFPSSPPPHSPLSHGHIPSAIVLPNATHDYNTS
  FSNSNAHKAEKKLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDI
  QMAHQNLMLDPMGSMSEVPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTPGVPMTSLER
  QRGYHKNSSQRHSISAMPKNLNSPNGVLLSRQPSMNRGGYMPTPTGAKVDYIQGTPVSVH
  LQPSLSRQSSYTSNGTLPRTGLKRTPSLKPDVPPKPSFVPQTPSVRPLNKYTY
• Function: Shows growth cone collapsing activity on dorsal root ganglion (DRG) neurons in vitro. May be a stop signal for the DRG neurons in their target areas, and possibly also for other neurons. May also be involved in the maintenance and remodeling of neuronal connections.
• KEGG Pathway: Axon guidance (hsa04360)
• Reactome Pathway: Other semaphorin interactions (R-HSA-416700)

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[1]
Cryohydrocytosis	DISMQHL3	Strong	Biomarker	[2]
Drug dependence	DIS9IXRC	Strong	Biomarker	[3]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[4]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[5]
Stomach cancer	DISKIJSX	Strong	Biomarker	[6]
Substance abuse	DIS327VW	Strong	Biomarker	[3]
Substance dependence	DISDRAAR	Strong	Biomarker	[3]
Bone osteosarcoma	DIST1004	moderate	Biomarker	[7]
Chronic renal failure	DISGG7K6	moderate	Genetic Variation	[8]
End-stage renal disease	DISXA7GG	moderate	Genetic Variation	[8]
Inflammatory bowel disease	DISGN23E	moderate	Genetic Variation	[9]
Osteosarcoma	DISLQ7E2	moderate	Biomarker	[7]
Ulcerative colitis	DIS8K27O	moderate	Genetic Variation	[9]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[10]
Complex neurodevelopmental disorder	DISB9AFI	Limited	Autosomal dominant	[11]
Lung carcinoma	DISTR26C	Limited	Genetic Variation	[12]
Malignant pleural mesothelioma	DIST2R60	Limited	Altered Expression	[13]
Neoplasm	DISZKGEW	Limited	Altered Expression	[13]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Semaphorin-6D (SEMA6D).	[14]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Semaphorin-6D (SEMA6D).	[15]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Semaphorin-6D (SEMA6D).	[16]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Semaphorin-6D (SEMA6D).	[17]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Semaphorin-6D (SEMA6D).	[18]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Semaphorin-6D (SEMA6D).	[19]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Semaphorin-6D (SEMA6D).	[20]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Semaphorin-6D (SEMA6D).	[21]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Semaphorin-6D (SEMA6D).	[22]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Semaphorin-6D (SEMA6D).	[23]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Semaphorin-6D (SEMA6D).	[24]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Semaphorin-6D (SEMA6D).	[25]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Semaphorin-6D (SEMA6D).	[20]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Semaphorin-6D (SEMA6D).	[22]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Semaphorin-6D (SEMA6D).	[27]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Semaphorin-6D (SEMA6D).	[28]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Semaphorin-6D (SEMA6D).	[30]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Semaphorin-6D (SEMA6D).	[31]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Semaphorin-6D (SEMA6D).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Semaphorin-6D (SEMA6D).	[29]

References

• [1] Genetic Markers of ADHD-Related Variations in Intracranial Volume.Am J Psychiatry. 2019 Mar 1;176(3):228-238. doi: 10.1176/appi.ajp.2018.18020149.
• [2] The association of semaphorins 3C, 5A and 6D with liver fibrosis stage in chronic hepatitis C.PLoS One. 2018 Dec 28;13(12):e0209481. doi: 10.1371/journal.pone.0209481. eCollection 2018.
• [3] Genome wide association for addiction: replicated results and comparisons of two analytic approaches.PLoS One. 2010 Jan 21;5(1):e8832. doi: 10.1371/journal.pone.0008832.
• [4] Genome-wide meta-analysis of depression identifies 102 independent variants and highlights the importance of the prefrontal brain regions.Nat Neurosci. 2019 Mar;22(3):343-352. doi: 10.1038/s41593-018-0326-7. Epub 2019 Feb 4.
• [5] Pleiotropic Meta-Analysis of Cognition, Education, and Schizophrenia Differentiates Roles of Early Neurodevelopmental and Adult Synaptic Pathways.Am J Hum Genet. 2019 Aug 1;105(2):334-350. doi: 10.1016/j.ajhg.2019.06.012.
• [6] Expression of semaphorin 6D in gastric carcinoma and its significance.World J Gastroenterol. 2006 Dec 7;12(45):7388-90. doi: 10.3748/wjg.v12.i45.7388.
• [7] A Sleeping Beauty forward genetic screen identifies new genes and pathways driving osteosarcoma development and metastasis.Nat Genet. 2015 Jun;47(6):615-24. doi: 10.1038/ng.3293. Epub 2015 May 11.
• [8] Novel genetic susceptibility loci for diabetic end-stage renal disease identified through robust naive Bayes classification.Diabetologia. 2014 Aug;57(8):1611-22. doi: 10.1007/s00125-014-3256-2. Epub 2014 May 29.
• [9] Genetic architecture differences between pediatric and adult-onset inflammatory bowel diseases in the Polish population.Sci Rep. 2016 Dec 23;6:39831. doi: 10.1038/srep39831.
• [10] RNA sequencing of Sleeping Beauty transposon-induced tumors detects transposon-RNA fusions in forward genetic cancer screens.Genome Res. 2016 Jan;26(1):119-29. doi: 10.1101/gr.188649.114. Epub 2015 Nov 9.
• [11] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [12] Large-scale association analysis identifies new lung cancer susceptibility loci and heterogeneity in genetic susceptibility across histological subtypes.Nat Genet. 2017 Jul;49(7):1126-1132. doi: 10.1038/ng.3892. Epub 2017 Jun 12.
• [13] The plexin-A1 receptor activates vascular endothelial growth factor-receptor 2 and nuclear factor-kappaB to mediate survival and anchorage-independent growth of malignant mesothelioma cells.Cancer Res. 2009 Feb 15;69(4):1485-93. doi: 10.1158/0008-5472.CAN-08-3659. Epub 2009 Jan 27.
• [14] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [15] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [16] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [17] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [18] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [19] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [20] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [21] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [22] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [23] Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
• [24] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [25] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [26] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [27] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [28] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [29] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [30] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [31] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.