Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUYVTSU)

• DOT Name: Thyroxine-binding globulin (SERPINA7)
• Synonyms: Serpin A7; T4-binding globulin
• Gene Name: SERPINA7
• Related Disease:
  Clear cell adenocarcinoma
  Epithelial ovarian cancer
  Hepatitis
  Hepatitis A virus infection
  Central congenital hypothyroidism
  Cholangiocarcinoma
  Congenital hypothyroidism
  Graves disease
  Growth delay due to insulin-like growth factor type 1 deficiency
  High blood pressure
  HIV infectious disease
  Homozygous familial hypercholesterolemia
  Hyperthyroidism
  Hyperthyroxinemia, familial dysalbuminemic
  Hypothyroidism
  Inborn error of metabolism
  Maturity-onset diabetes of the young
  Plasma cell myeloma
  Polyneuropathy
  Thyrotoxicosis
  Chronic obstructive pulmonary disease
  Neoplasm
  Advanced cancer
• UniProt ID: THBG_HUMAN
• PDB ID: 2CEO; 2RIV; 2RIW; 2XN3; 2XN5; 2XN6; 2XN7; 4X30; 4YIA
• Pfam ID: PF00079
• Sequence:
  MSPFLYLVLLVLGLHATIHCASPEGKVTACHSSQPNATLYKMSSINADFAFNLYRRFTVE
  TPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVEIQHGFQHLICSLN
  FPKKELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQEINSHVEMQ
  TKGKVVGLIQDLKPNTIMVLVNYIHFKAQWANPFDPSKTEDSSSFLIDKTTTVQVPMMHQ
  MEQYYHLVDMELNCTVLQMDYSKNALALFVLPKEGQMESVEAAMSSKTLKKWNRLLQKGW
  VDLFVPKFSISATYDLGATLLKMGIQHAYSENADFSGLTEDNGLKLSNAAHKAVLHIGEK
  GTEAAAVPEVELSDQPENTFLHPIIQIDRSFMLLILERSTRSILFLGKVVNPTEA
• Function: Major thyroid hormone transport protein in serum.
• Tissue Specificity: Expressed by the liver and secreted in plasma.
• KEGG Pathway: Thyroid hormone synthesis (hsa04918)

Molecular Interaction Atlas (MIA) of This DOT

23 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Clear cell adenocarcinoma	DISYUGHZ	Definitive	Biomarker	[1]
Epithelial ovarian cancer	DIS56MH2	Definitive	Genetic Variation	[1]
Hepatitis	DISXXX35	Definitive	Biomarker	[2]
Hepatitis A virus infection	DISUMFQV	Definitive	Biomarker	[2]
Central congenital hypothyroidism	DIS6FWEW	Strong	Altered Expression	[3]
Cholangiocarcinoma	DIS71F6X	Strong	Genetic Variation	[4]
Congenital hypothyroidism	DISL5XVU	Strong	Biomarker	[5]
Graves disease	DISU4KOQ	Strong	Biomarker	[6]
Growth delay due to insulin-like growth factor type 1 deficiency	DISHA2HH	Strong	Biomarker	[7]
High blood pressure	DISY2OHH	Strong	Biomarker	[7]
HIV infectious disease	DISO97HC	Strong	Biomarker	[8]
Homozygous familial hypercholesterolemia	DISRCNCF	Strong	Biomarker	[9]
Hyperthyroidism	DISX87ZH	Strong	Altered Expression	[10]
Hyperthyroxinemia, familial dysalbuminemic	DIS0BPAW	Strong	Biomarker	[11]
Hypothyroidism	DISR0H6D	Strong	Altered Expression	[12]
Inborn error of metabolism	DISO5FAY	Strong	Biomarker	[13]
Maturity-onset diabetes of the young	DISG75M5	Strong	Biomarker	[14]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[15]
Polyneuropathy	DISB9G3W	Strong	Biomarker	[16]
Thyrotoxicosis	DISWH7BV	Strong	Biomarker	[2]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Biomarker	[17]
Neoplasm	DISZKGEW	moderate	Biomarker	[18]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[19]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Leuprolide	DM5XPIJ	Approved	Thyroxine-binding globulin (SERPINA7) increases the Thyroid hyperfunction disorders ADR of Leuprolide.	[34]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Thyroxine-binding globulin (SERPINA7).	[20]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Thyroxine-binding globulin (SERPINA7).	[21]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Thyroxine-binding globulin (SERPINA7).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Thyroxine-binding globulin (SERPINA7).	[23]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Thyroxine-binding globulin (SERPINA7).	[21]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Thyroxine-binding globulin (SERPINA7).	[24]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Thyroxine-binding globulin (SERPINA7).	[25]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Thyroxine-binding globulin (SERPINA7).	[26]
Lindane	DMB8CNL	Approved	Lindane decreases the expression of Thyroxine-binding globulin (SERPINA7).	[28]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Thyroxine-binding globulin (SERPINA7).	[29]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Thyroxine-binding globulin (SERPINA7).	[30]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Thyroxine-binding globulin (SERPINA7).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Thyroxine-binding globulin (SERPINA7).	[31]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of Thyroxine-binding globulin (SERPINA7).	[24]

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Liothyronine	DM6IR3P	Approved	Liothyronine affects the binding of Thyroxine-binding globulin (SERPINA7).	[27]
L-thyroxine	DM83HWL	Investigative	L-thyroxine affects the binding of Thyroxine-binding globulin (SERPINA7).	[33]
3,5-dibromo-2-(2,4-dibromophenoxy)phenol	DMCEY6O	Investigative	3,5-dibromo-2-(2,4-dibromophenoxy)phenol affects the binding of Thyroxine-binding globulin (SERPINA7).	[27]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Thyroxine-binding globulin (SERPINA7).	[32]

References

• [1] Common Genetic Variation In Cellular Transport Genes and Epithelial Ovarian Cancer (EOC) Risk.PLoS One. 2015 Jun 19;10(6):e0128106. doi: 10.1371/journal.pone.0128106. eCollection 2015.
• [2] Normal cellular uptake of thyroxine from serum of patients with familial dysalbuminemic hyperthyroxinemia or elevated thyroxine-binding globulin.J Clin Endocrinol Metab. 1988 Dec;67(6):1166-70. doi: 10.1210/jcem-67-6-1166.
• [3] Detecting Congenital Central Hypothyroidism by Newborn Screening: Difficulty in Distinguishing from Congenital Thyroxine-Binding Globulin Deficiency.Horm Res Paediatr. 2017;88(5):331-338. doi: 10.1159/000479367. Epub 2017 Sep 14.
• [4] Epithelial Transforming Growth Factor- Signaling Does Not Contribute to Liver Fibrosis but Protects Mice From Cholangiocarcinoma.Gastroenterology. 2016 Mar;150(3):720-33. doi: 10.1053/j.gastro.2015.11.039. Epub 2015 Nov 26.
• [5] Molecular spectrum of TSH subunit gene defects in central hypothyroidism in the UK and Ireland.Clin Endocrinol (Oxf). 2017 Mar;86(3):410-418. doi: 10.1111/cen.13149. Epub 2016 Aug 4.
• [6] Graves' disease associated with familial deficiency of thyroxine-binding globulin.J Clin Endocrinol Metab. 1977 Feb;44(2):242-7. doi: 10.1210/jcem-44-2-242.
• [7] Insulin-like growth factor 1 deficiency exacerbates hypertension-induced cerebral microhemorrhages in mice, mimicking the aging phenotype.Aging Cell. 2017 Jun;16(3):469-479. doi: 10.1111/acel.12583. Epub 2017 Mar 14.
• [8] Dendritic cell immunotherapy followed by cART interruption during HIV-1 infection induces plasma protein markers of cellular immunity and neutrophil recruitment.PLoS One. 2018 Feb 1;13(2):e0192278. doi: 10.1371/journal.pone.0192278. eCollection 2018.
• [9] Non-Clinical Study Examining AAV8.TBG.hLDLR Vector-Associated Toxicity in Chow-Fed Wild-Type and LDLR(+/-) Rhesus Macaques.Hum Gene Ther Clin Dev. 2017 Mar;28(1):39-50. doi: 10.1089/humc.2017.014.
• [10] Therapeutic Effect of Scutellaria baicalensis on L-Thyroxine-Induced Hyperthyroidism Rats.Evid Based Complement Alternat Med. 2019 Sep 15;2019:3239649. doi: 10.1155/2019/3239649. eCollection 2019.
• [11] Artifactually elevated serum-free thyroxine levels measured by equilibrium dialysis in a pregnant woman with familial dysalbuminemic hyperthyroxinemia.Thyroid. 2004 Feb;14(2):155-60. doi: 10.1089/105072504322880409.
• [12] The hepatic biosynthesis of rat thyroxine binding globulin (TBG): demonstration, ontogenesis, and up-regulation in experimental hypothyroidism.Biochem Biophys Res Commun. 1990 Feb 28;167(1):317-22. doi: 10.1016/0006-291x(90)91767-m.
• [13] Replacement of Leu227 by Pro in thyroxine-binding globulin (TBG) is associated with complete TBG deficiency in three of eight families with this inherited defect.J Clin Endocrinol Metab. 1990 Mar;70(3):804-9. doi: 10.1210/jcem-70-3-804.
• [14] Quantitative Evaluation of Serum Proteins Uncovers a Protein Signature Related to Maturity-Onset Diabetes of the Young (MODY).J Proteome Res. 2018 Jan 5;17(1):670-679. doi: 10.1021/acs.jproteome.7b00727. Epub 2017 Dec 14.
• [15] Metabolism of thyroxine-binding globulin in man. Abnormal rate of synthesis in inherited thyroxine-binding globulin deficiency and excess.J Clin Invest. 1976 Feb;57(2):485-95. doi: 10.1172/JCI108301.
• [16] An outline of inherited disorders of the thyroid hormone generating system.Thyroid. 2003 Aug;13(8):771-801. doi: 10.1089/105072503768499671.
• [17] Identification of thyroxine-binding globulin as a candidate plasma marker of chronic obstructive pulmonary disease.Int J Chron Obstruct Pulmon Dis. 2017 May 25;12:1549-1564. doi: 10.2147/COPD.S137806. eCollection 2017.
• [18] Therapeutic Targeting of Protein Kinase CK2 Gene Expression in Feline Oral Squamous Cell Carcinoma: A Naturally Occurring Large-Animal Model of Head and Neck Cancer.Hum Gene Ther Clin Dev. 2017 Jun;28(2):80-86. doi: 10.1089/humc.2017.008. Epub 2017 Mar 23.
• [19] Mechanism and efficacy of sub-50-nm tenfibgen nanocapsules for cancer cell-directed delivery of anti-CK2 RNAi to primary and metastatic squamous cell carcinoma.Mol Cancer Ther. 2014 Aug;13(8):2018-29. doi: 10.1158/1535-7163.MCT-14-0166. Epub 2014 May 27.
• [20] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [21] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [22] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [23] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [24] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [25] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [26] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [27] Structure-based investigation on the binding interaction of hydroxylated polybrominated diphenyl ethers with thyroxine transport proteins. Toxicology. 2010 Nov 9;277(1-3):20-8. doi: 10.1016/j.tox.2010.08.012. Epub 2010 Sep 8.
• [28] Thyroid function and plasma concentrations of polyhalogenated compounds in Inuit adults. Environ Health Perspect. 2009 Sep;117(9):1380-6. doi: 10.1289/ehp.0900633. Epub 2009 May 12.
• [29] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [30] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [31] Identification of AhR-regulated genes involved in PAH-induced immunotoxicity using a highly-sensitive DNA chip, 3D-Gene human immunity and metabolic syndrome 9k. Toxicol In Vitro. 2010 Feb;24(1):85-91.
• [32] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [33] Biosensor recognition of thyroid-disrupting chemicals using transport proteins. Anal Chem. 2006 Feb 15;78(4):1107-14. doi: 10.1021/ac051399i.
• [34] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.