Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWKRVZC)

• DOT Name: Syndecan-1 (SDC1)
• Synonyms: SYND1; CD antigen CD138
• Gene Name: SDC1
• UniProt ID: SDC1_HUMAN
• PDB ID: 4GVC; 4GVD; 6EJE
• Pfam ID: PF01034
• Sequence:
  MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
  TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE
  ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT
  EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT
  GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
  KPTKQEEFYA
• Function: Cell surface proteoglycan that contains both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP. Able to induce its own expression in dental mesenchymal cells and also in the neighboring dental epithelial cells via an MSX1-mediated pathway.
• Tissue Specificity: Detected in placenta (at protein level) . Detected in fibroblasts (at protein level) .
• KEGG Pathway:
  ECM-receptor interaction (hsa04512)
  Cell adhesion molecules (hsa04514)
  Cytoskeleton in muscle cells (hsa04820)
  Malaria (hsa05144)
  Proteoglycans in cancer (hsa05205)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  HS-GAG biosynthesis (R-HSA-2022928)
  HS-GAG degradation (R-HSA-2024096)
  Cell surface interactions at the vascular wall (R-HSA-202733)
  Syndecan interactions (R-HSA-3000170)
  Defective B4GALT7 causes EDS, progeroid type (R-HSA-3560783)
  Defective B3GAT3 causes JDSSDHD (R-HSA-3560801)
  Defective EXT2 causes exostoses 2 (R-HSA-3656237)
  Defective EXT1 causes exostoses 1, TRPS2 and CHDS (R-HSA-3656253)
  Defective B3GALT6 causes EDSP2 and SEMDJL1 (R-HSA-4420332)
  Other interleukin signaling (R-HSA-449836)
  Attachment and Entry (R-HSA-9694614)
  Retinoid metabolism and transport (R-HSA-975634)
  A tetrasaccharide linker sequence is required for GAG synthesis (R-HSA-1971475)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Syndecan-1 (SDC1) affects the response to substance of Temozolomide.	[29]
DTI-015	DMXZRW0	Approved	Syndecan-1 (SDC1) affects the response to substance of DTI-015.	[29]

32 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Syndecan-1 (SDC1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Syndecan-1 (SDC1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Syndecan-1 (SDC1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Syndecan-1 (SDC1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Syndecan-1 (SDC1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Syndecan-1 (SDC1).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Syndecan-1 (SDC1).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Syndecan-1 (SDC1).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Syndecan-1 (SDC1).	[10]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Syndecan-1 (SDC1).	[11]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Syndecan-1 (SDC1).	[12]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Syndecan-1 (SDC1).	[13]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Syndecan-1 (SDC1).	[14]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Syndecan-1 (SDC1).	[15]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of Syndecan-1 (SDC1).	[16]
Daunorubicin	DMQUSBT	Approved	Daunorubicin increases the expression of Syndecan-1 (SDC1).	[15]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Syndecan-1 (SDC1).	[7]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of Syndecan-1 (SDC1).	[7]
Ardeparin	DMYRX8B	Approved	Ardeparin decreases the expression of Syndecan-1 (SDC1).	[17]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the expression of Syndecan-1 (SDC1).	[15]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Syndecan-1 (SDC1).	[18]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate decreases the expression of Syndecan-1 (SDC1).	[19]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Syndecan-1 (SDC1).	[2]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Syndecan-1 (SDC1).	[20]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Syndecan-1 (SDC1).	[21]
WIN-55212-2	DMACBIW	Terminated	WIN-55212-2 decreases the expression of Syndecan-1 (SDC1).	[22]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Syndecan-1 (SDC1).	[23]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Syndecan-1 (SDC1).	[24]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Syndecan-1 (SDC1).	[25]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Syndecan-1 (SDC1).	[26]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Syndecan-1 (SDC1).	[27]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid affects the expression of Syndecan-1 (SDC1).	[28]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Syndecan-1 (SDC1).	[9]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Apratastat	DM8W4N9	Phase 2	Apratastat decreases the secretion of Syndecan-1 (SDC1).	[19]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [10] Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
• [11] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [12] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [13] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [14] The myeloma cell antigen syndecan-1 is lost by apoptotic myeloma cells. Br J Haematol. 1998 Mar;100(4):637-46. doi: 10.1046/j.1365-2141.1998.00623.x.
• [15] Characterization of DNA reactive and non-DNA reactive anticancer drugs by gene expression profiling. Mutat Res. 2007 Jun 1;619(1-2):16-29. doi: 10.1016/j.mrfmmm.2006.12.007. Epub 2007 Feb 8.
• [16] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [17] Biochemical and toxicological evaluation of nano-heparins in cell functional properties, proteasome activation and expression of key matrix molecules. Toxicol Lett. 2016 Jan 5;240(1):32-42. doi: 10.1016/j.toxlet.2015.10.005. Epub 2015 Oct 22.
• [18] Gene expression preferentially regulated by tamoxifen in breast cancer cells and correlations with clinical outcome. Cancer Res. 2006 Jul 15;66(14):7334-40.
• [19] A disintegrin and metalloproteinase 17 (ADAM17) mediates inflammation-induced shedding of syndecan-1 and -4 by lung epithelial cells. J Biol Chem. 2010 Jan 1;285(1):555-64. doi: 10.1074/jbc.M109.059394. Epub 2009 Oct 29.
• [20] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [21] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [22] Cannabinoid WIN?55,212?2 mesylate inhibits ADAMTS?4 activity in human osteoarthritic articular chondrocytes by inhibiting expression of syndecan?1. Mol Med Rep. 2016 Jun;13(6):4569-76. doi: 10.3892/mmr.2016.5137. Epub 2016 Apr 15.
• [23] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [24] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [25] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [26] Cadmium inhibits forskolin-induced differentiation of human placental BeWo cells. J Toxicol Sci. 2022;47(8):309-315. doi: 10.2131/jts.47.309.
• [27] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.
• [28] Cancer-related proteins in serum are altered in workers occupationally exposed to polycyclic aromatic hydrocarbons: a cross-sectional study. Carcinogenesis. 2019 Jul 6;40(6):771-781. doi: 10.1093/carcin/bgz022.
• [29] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.