Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWXKKTJ)

DOT Name Sperm equatorial segment protein 1 (SPESP1)
Synonyms SP-ESP; Equatorial segment protein; ESP; Glycosylated 38 kDa sperm protein C-7/8
Gene Name SPESP1
Related Disease
Arthritis ( )
Rheumatoid arthritis ( )
Advanced cancer ( )
Colitis ( )
Pneumonia ( )
Pneumonitis ( )
Urinary tract infection ( )
Chronic renal failure ( )
End-stage renal disease ( )
Nephropathy ( )
Non-insulin dependent diabetes ( )
Acute myelogenous leukaemia ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
Marfan syndrome ( )
Myocardial infarction ( )
UniProt ID
SPESP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15754
Sequence
MKPLVLLVALLLWPSSVPAYPSITVTPDEEQNLNHYIQVLENLVRSVPSGEPGREKKSNS
PKHVYSIASKGSKFKELVTHGDASTENDVLTNPISEETTTFPTGGFTPEIGKKKHTESTP
FWSIKPNNVSIVLHAEEPYIENEEPEPEPEPAAKQTEAPRMLPVVTESSTSPYVTSYKSP
VTTLDKSTGIGISTESEDVPQLSGETAIEKPEEFGKHPESWNNDDILKKILDINSQVQQA
LLSDTSNPAYREDIEASKDHLKRSLALAAAAEHKLKTMYKSQLLPVGRTSNKIDDIETVI
NMLCNSRSKLYEYLDIKCVPPEMREKAATVFNTLKNMCRSRRVTALLKVY
Function Involved in fertilization ability of sperm.
Tissue Specificity
Highly expressed in testis, where it is localized in the acrosome of postmeiotic stages of spermiogenesis (round and elongating spermatids and in ejaculated spermatozoa) (at protein level). Poorly expressed in placenta and fetal lung.

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Arthritis DIST1YEL Definitive Biomarker [1]
Rheumatoid arthritis DISTSB4J Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Biomarker [2]
Colitis DISAF7DD Strong Biomarker [3]
Pneumonia DIS8EF3M Strong Biomarker [4]
Pneumonitis DIS88E0K Strong Biomarker [4]
Urinary tract infection DISMT6UV Strong Biomarker [5]
Chronic renal failure DISGG7K6 moderate Genetic Variation [6]
End-stage renal disease DISXA7GG moderate Genetic Variation [6]
Nephropathy DISXWP4P moderate Biomarker [6]
Non-insulin dependent diabetes DISK1O5Z moderate Genetic Variation [6]
Acute myelogenous leukaemia DISCSPTN Limited Genetic Variation [7]
Coronary atherosclerosis DISKNDYU Limited Genetic Variation [8]
Coronary heart disease DIS5OIP1 Limited Genetic Variation [8]
Marfan syndrome DISVEUWZ Limited Genetic Variation [9]
Myocardial infarction DIS655KI Limited Genetic Variation [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Sperm equatorial segment protein 1 (SPESP1). [10]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Sperm equatorial segment protein 1 (SPESP1). [11]
------------------------------------------------------------------------------------

References

1 A pure polysaccharide from Ephedra sinica treating on arthritis and inhibiting cytokines expression.Int J Biol Macromol. 2016 May;86:177-88. doi: 10.1016/j.ijbiomac.2016.01.010. Epub 2016 Mar 17.
2 Validation of the Spanish Version of the Quality of Dying and Death Questionnaire (QODD-ESP) in a Home-Based Cancer Palliative Care Program and Development of the QODD-ESP-12.J Pain Symptom Manage. 2017 Jun;53(6):1042-1049.e3. doi: 10.1016/j.jpainsymman.2017.02.005. Epub 2017 Mar 16.
3 Hookworm-Derived Metabolites Suppress Pathology in a Mouse Model of Colitis and Inhibit Secretion of Key Inflammatory Cytokines in Primary Human Leukocytes.Infect Immun. 2019 Mar 25;87(4):e00851-18. doi: 10.1128/IAI.00851-18. Print 2019 Apr.
4 Polysaccharide from Ephedra sinica Stapf inhibits inflammation expression by regulating Factor-1/Smad2 signaling.Int J Biol Macromol. 2018 Jan;106:947-954. doi: 10.1016/j.ijbiomac.2017.08.096. Epub 2017 Aug 19.
5 Survey for virulence determinants among Enterococcus faecalis isolated from different sources.J Med Microbiol. 2004 Jan;53(Pt 1):13-20. doi: 10.1099/jmm.0.05353-0.
6 Analysis of coding variants identified from exome sequencing resources for association with diabetic and non-diabetic nephropathy in African Americans.Hum Genet. 2014 Jun;133(6):769-779. doi: 10.1007/s00439-013-1415-z. Epub 2014 Jan 3.
7 Virulence determinants in vancomycin-resistant Enterococcus faecium vanB: clonal distribution, prevalence and significance of esp and hyl in Australian patients with haematological disorders.J Hosp Infect. 2008 Feb;68(2):137-44. doi: 10.1016/j.jhin.2007.10.017.
8 Common and Rare Genetic Variation in CCR2, CCR5, or CX3CR1 and Risk of Atherosclerotic Coronary Heart Disease and Glucometabolic Traits.Circ Cardiovasc Genet. 2016 Jun;9(3):250-8. doi: 10.1161/CIRCGENETICS.115.001374. Epub 2016 Mar 24.
9 New population-based exome data question the pathogenicity of some genetic variants previously associated with Marfan syndrome.BMC Genet. 2014 Jun 18;15:74. doi: 10.1186/1471-2156-15-74.
10 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
11 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.