Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXGVHAB)

• DOT Name: All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1)
• Synonyms: All-trans-decaprenyl-diphosphate synthase subunit 1; EC 2.5.1.91; Decaprenyl pyrophosphate synthase subunit 1; Decaprenyl-diphosphate synthase subunit 1; Solanesyl-diphosphate synthase subunit 1; Trans-prenyltransferase 1; TPT 1
• Gene Name: PDSS1
• Related Disease:
  Lung cancer
  Lung carcinoma
  Mycoses
  Anxiety
  Anxiety disorder
  Coenzyme Q10 deficiency
  Congenital heart disease
  Deafness-encephaloneuropathy-obesity-valvulopathy syndrome
  Depression
  Hyperlipidemia
  Hyperparathyroidism
  Immunodeficiency
  Polydactyly
  Polydactyly of a triphalangeal thumb
  Post-traumatic stress disorder
  Social phobia
  Amyotrophic lateral sclerosis
  Colorectal carcinoma
  Coxopodopatellar syndrome
  Neoplasm
  Psychotic disorder
  Schizophrenia
• UniProt ID: DPS1_HUMAN
• EC Number: 2.5.1.91
• Pfam ID: PF00348
• Sequence:
  MASRWWRWRRGCSWKPAARSPGPGSPGRAGPLGPSAAAEVRAQVHRRKGLDLSQIPYINL
  VKHLTSACPNVCRISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSE
  LKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNSRHVQASQRAIALIAEMIHTASLVHD
  DVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVR
  GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHEIAYQYGKNVG
  IAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDV
  DRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLTRDK
• Function: Heterotetrameric enzyme that catalyzes the condensation of farnesyl diphosphate (FPP), which acts as a primer, and isopentenyl diphosphate (IPP) to produce prenyl diphosphates of varying chain lengths and participates in the determination of the side chain of ubiquinone. Supplies nona and decaprenyl diphosphate, the precursors for the side chain of the isoprenoid quinones ubiquinone-9 (Q9)and ubiquinone-10 (Q10) respectively. The enzyme adds isopentenyl diphosphate molecules sequentially to farnesyl diphosphate with trans stereochemistry.
• KEGG Pathway: Terpenoid backbone biosynthesis (hsa00900)
• Reactome Pathway: Ubiquinol biosynthesis (R-HSA-2142789)
• BioCyc Pathway: MetaCyc:HS07530-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Definitive	Biomarker	[1]
Lung carcinoma	DISTR26C	Definitive	Biomarker	[1]
Mycoses	DIS9K7PB	Definitive	Genetic Variation	[2]
Anxiety	DISIJDBA	Strong	Biomarker	[3]
Anxiety disorder	DISBI2BT	Strong	Biomarker	[3]
Coenzyme Q10 deficiency	DIS1HGDF	Strong	Genetic Variation	[4]
Congenital heart disease	DISQBA23	Strong	Genetic Variation	[5]
Deafness-encephaloneuropathy-obesity-valvulopathy syndrome	DIS0BPTI	Strong	Autosomal recessive	[4]
Depression	DIS3XJ69	Strong	Biomarker	[6]
Hyperlipidemia	DIS61J3S	Strong	Biomarker	[7]
Hyperparathyroidism	DIS4FVAT	Strong	Biomarker	[8]
Immunodeficiency	DIS093I0	Strong	Biomarker	[9]
Polydactyly	DIS25BMZ	Strong	Altered Expression	[5]
Polydactyly of a triphalangeal thumb	DIS7WCFY	Strong	Genetic Variation	[5]
Post-traumatic stress disorder	DISHL1EY	Strong	Biomarker	[10]
Social phobia	DISQGN78	Strong	Biomarker	[11]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Biomarker	[12]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[13]
Coxopodopatellar syndrome	DISMJAT7	Limited	Biomarker	[14]
Neoplasm	DISZKGEW	Limited	Biomarker	[13]
Psychotic disorder	DIS4UQOT	Limited	Biomarker	[15]
Schizophrenia	DISSRV2N	Limited	Biomarker	[15]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[16]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[17]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[18]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[19]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[20]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[21]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[22]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[23]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[24]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[24]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[25]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[26]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[27]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[29]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[30]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[31]
Farnesol	DMV2X1B	Investigative	Farnesol increases the expression of All trans-polyprenyl-diphosphate synthase PDSS1 (PDSS1).	[32]

References

• [1] Chemical identification of a sulfated glucan from Antrodia cinnamomea and its anti-cancer functions via inhibition of EGFR and mTOR activity.Carbohydr Polym. 2018 Dec 15;202:536-544. doi: 10.1016/j.carbpol.2018.09.009. Epub 2018 Sep 6.
• [2] Cloning and characterization of decaprenyl diphosphate synthase from three different fungi.Appl Microbiol Biotechnol. 2017 Feb;101(4):1559-1571. doi: 10.1007/s00253-016-7963-0. Epub 2016 Nov 11.
• [3] Single prolonged stress PTSD model triggers progressive severity of anxiety, altered gene expression in locus coeruleus and hypothalamus and effected sensitivity to NPY.Eur Neuropsychopharmacol. 2019 Apr;29(4):482-492. doi: 10.1016/j.euroneuro.2019.02.010. Epub 2019 Mar 14.
• [4] Prenyldiphosphate synthase, subunit 1 (PDSS1) and OH-benzoate polyprenyltransferase (COQ2) mutations in ubiquinone deficiency and oxidative phosphorylation disorders. J Clin Invest. 2007 Mar;117(3):765-72. doi: 10.1172/JCI29089.
• [5] Microduplication of 7q36.3 encompassing the SHH longrange regulator (ZRS) in a patient with triphalangeal thumbpolysyndactyly syndrome and congenital heart disease.Mol Med Rep. 2017 Feb;15(2):793-797. doi: 10.3892/mmr.2016.6092. Epub 2016 Dec 29.
• [6] Factors Associated With Presenteeism at Work in Type 2 Diabetes Mellitus.J Occup Environ Med. 2018 Dec;60(12):1116-1119. doi: 10.1097/JOM.0000000000001446.
• [7] Antihyperlipidemic and hepatoprotective properties of alkali- and enzyme-extractable polysaccharides by Dictyophora indusiata.Sci Rep. 2019 Oct 3;9(1):14266. doi: 10.1038/s41598-019-50717-9.
• [8] Compared effects of calcium and sodium polystyrene sulfonate on mineral and bone metabolism and volume overload in pre-dialysis patients with hyperkalemia.Clin Exp Nephrol. 2018 Feb;22(1):35-44. doi: 10.1007/s10157-017-1412-y. Epub 2017 Apr 18.
• [9] Evaluation of different RNA extraction methods and storage conditions of dried plasma or blood spots for human immunodeficiency virus type 1 RNA quantification and PCR amplification for drug resistance testing.J Clin Microbiol. 2009 Apr;47(4):1107-18. doi: 10.1128/JCM.02255-08. Epub 2009 Feb 4.
• [10] Hyperbaric oxygen therapy restored traumatic stress-induced dysregulation of fear memory and related neurochemical abnormalities.Behav Brain Res. 2019 Feb 1;359:861-870. doi: 10.1016/j.bbr.2018.07.014. Epub 2018 Jul 26.
• [11] Factors associated with social anxiety in South Korean adults with epilepsy.Epilepsy Behav. 2019 Dec;101(Pt A):106569. doi: 10.1016/j.yebeh.2019.106569. Epub 2019 Oct 30.
• [12] Theme 7 Pre-clinical therapeutic strategies.Amyotroph Lateral Scler Frontotemporal Degener. 2019 Nov;20(sup1):217-245. doi: 10.1080/21678421.2019.1646995.
• [13] Glucuronorhamnoxylan from Capsosiphon fulvescens inhibits the growth of HT-29 human colon cancer cells in vitro and in vivo via induction of apoptotic cell death.Int J Biol Macromol. 2019 Mar 1;124:1060-1068. doi: 10.1016/j.ijbiomac.2018.12.001. Epub 2018 Dec 3.
• [14] Spatial and temporal regulation of the endoproteolytic activity of the SPS-sensor-controlled Ssy5 signaling protease.Mol Biol Cell. 2019 Oct 1;30(21):2709-2720. doi: 10.1091/mbc.E19-02-0096. Epub 2019 Aug 28.
• [15] Sex-specific rates of transmission of psychosis in the New England high-risk family study.Schizophr Res. 2011 May;128(1-3):150-5. doi: 10.1016/j.schres.2011.01.019. Epub 2011 Feb 18.
• [16] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [17] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [18] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [19] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [20] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [21] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [22] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [23] Effect of mitochondrial dysfunction and oxidative stress on endogenous levels of coenzyme Q(10) in human cells. J Biochem Mol Toxicol. 2011 Sep-Oct;25(5):280-9. doi: 10.1002/jbt.20387. Epub 2011 Feb 9.
• [24] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [25] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [26] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [27] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [28] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [29] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [30] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [31] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [32] Farnesol induces fatty acid oxidation and decreases triglyceride accumulation in steatotic HepaRG cells. Toxicol Appl Pharmacol. 2019 Feb 15;365:61-70.