Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXLEN11)

DOT Name Killer cell immunoglobulin-like receptor 2DS5 (KIR2DS5)
Synonyms CD158 antigen-like family member G; Natural killer-associated transcript 9; NKAT-9; CD antigen CD158g
Gene Name KIR2DS5
Related Disease
Malaria ( )
Ankylosing spondylitis ( )
Autoimmune thrombocytopenia ( )
Bronchiolitis obliterans syndrome ( )
Dengue ( )
Endometriosis ( )
Essential hypertension ( )
Heparin-induced thrombocytopenia ( )
High blood pressure ( )
Idiopathic thrombocytopenic purpura ( )
Immune thrombocytopenia ( )
Inflammatory bowel disease ( )
Irritable bowel syndrome ( )
leukaemia ( )
Leukemia ( )
Rheumatoid arthritis ( )
Syphilis ( )
Systemic lupus erythematosus ( )
Rectal carcinoma ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid tumor ( )
UniProt ID
KI2S5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00047
Sequence
MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLL
HREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRT
FQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQE
VSYA
Function
Activating natural killer (NK) receptor that recognizes C2 epitopes of HLA-C alleles. Bridging the innate and adaptive immune systems, NK cells express a number of cell surface receptors which either inhibit or stimulate their cytotoxicity. Able to activate NK cells citotoxicity and cytokine production such as IFNG. Receptor functions are attenuated even lost in some alleles, such as KIR2DS5*002 represented in this entry.
Tissue Specificity Expressed on a discrete subset of peripheral blood NK cells.
KEGG Pathway
Antigen processing and presentation (hsa04612 )
.tural killer cell mediated cytotoxicity (hsa04650 )
Reactome Pathway
DAP12 interactions (R-HSA-2172127 )

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Malaria DISQ9Y50 Definitive Altered Expression [1]
Ankylosing spondylitis DISRC6IR Strong Biomarker [2]
Autoimmune thrombocytopenia DISNF0OI Strong Biomarker [3]
Bronchiolitis obliterans syndrome DISCK9IV Strong Biomarker [4]
Dengue DISKH221 Strong Biomarker [5]
Endometriosis DISX1AG8 Strong Biomarker [6]
Essential hypertension DIS7WI98 Strong Biomarker [7]
Heparin-induced thrombocytopenia DISAKJKZ Strong Biomarker [8]
High blood pressure DISY2OHH Strong Biomarker [7]
Idiopathic thrombocytopenic purpura DISFKGJU Strong Biomarker [3]
Immune thrombocytopenia DISVCBNS Strong Biomarker [3]
Inflammatory bowel disease DISGN23E Strong Genetic Variation [9]
Irritable bowel syndrome DIS27206 Strong Genetic Variation [9]
leukaemia DISS7D1V Strong Biomarker [10]
Leukemia DISNAKFL Strong Biomarker [10]
Rheumatoid arthritis DISTSB4J Strong Biomarker [11]
Syphilis DISJ73BS Strong Biomarker [12]
Systemic lupus erythematosus DISI1SZ7 Strong Genetic Variation [13]
Rectal carcinoma DIS8FRR7 Limited Biomarker [14]
Thyroid cancer DIS3VLDH Limited Genetic Variation [15]
Thyroid gland carcinoma DISMNGZ0 Limited Genetic Variation [15]
Thyroid tumor DISLVKMD Limited Genetic Variation [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 22 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the expression of Killer cell immunoglobulin-like receptor 2DS5 (KIR2DS5). [16]
QUERCITRIN DM1DH96 Investigative QUERCITRIN affects the expression of Killer cell immunoglobulin-like receptor 2DS5 (KIR2DS5). [17]
------------------------------------------------------------------------------------

References

1 Killer-cell immunoglobulin-like receptors and falciparum malaria in southwest Nigeria.Hum Immunol. 2014 Aug;75(8):816-21. doi: 10.1016/j.humimm.2014.06.002. Epub 2014 Jun 11.
2 Does the KIR2DS5 gene protect from some human diseases?.PLoS One. 2010 Aug 26;5(8):e12381. doi: 10.1371/journal.pone.0012381.
3 The presence of KIR2DS5 confers protection against adult immune thrombocytopenia.Tissue Antigens. 2014 Mar;83(3):154-60. doi: 10.1111/tan.12295. Epub 2014 Feb 12.
4 The killer immunoglobulin-like receptor (KIR) group A haplotype is associated with bronchiolitis obliterans syndrome after lung transplantation.J Heart Lung Transplant. 2008 Sep;27(9):995-1001. doi: 10.1016/j.healun.2008.06.006.
5 Association of HLA class-I and inhibitory KIR genotypes in Gabonese patients infected by Chikungunya or Dengue type-2 viruses.PLoS One. 2014 Sep 29;9(9):e108798. doi: 10.1371/journal.pone.0108798. eCollection 2014.
6 KIR2DS5 in the presence of HLA-C C2 protects against endometriosis.Immunogenetics. 2015 Apr;67(4):203-9. doi: 10.1007/s00251-015-0828-3. Epub 2015 Mar 1.
7 Association between killer cell immunoglobulin-like receptor 2DS5 gene with essential hypertension in the Chinese Han patients.Int J Immunogenet. 2017 Dec;44(6):343-349. doi: 10.1111/iji.12342. Epub 2017 Nov 3.
8 Influence of Human Leukocyte Antigen (HLA) Alleles and Killer Cell Immunoglobulin-Like Receptors (KIR) Types on Heparin-Induced Thrombocytopenia (HIT).Pharmacotherapy. 2017 Sep;37(9):1164-1171. doi: 10.1002/phar.1983. Epub 2017 Sep 4.
9 Killer immunoglobulin-like receptor repertoire analysis in a Caucasian Spanish cohort with inflammatory bowel disease.Microbiol Immunol. 2016 Nov;60(11):787-792. doi: 10.1111/1348-0421.12447.
10 KIR2DS5 is associated with leukemia free survival after HLA identical stem cell transplantation in chronic myeloid leukemia patients.Mol Immunol. 2008 Aug;45(13):3631-8. doi: 10.1016/j.molimm.2008.04.016. Epub 2008 Jun 16.
11 Association of Killer Cell Immunoglobulin- Like Receptor Genes in Iranian Patients with Rheumatoid Arthritis.PLoS One. 2015 Dec 11;10(12):e0143757. doi: 10.1371/journal.pone.0143757. eCollection 2015.
12 Human leukocyte antigen-C and killer cell immunoglobulin-like receptor gene polymorphisms among patients with syphilis in a Chinese Han population.APMIS. 2012 Oct;120(10):828-35. doi: 10.1111/j.1600-0463.2012.02911.x. Epub 2012 May 7.
13 Systemic lupus erythematosus: association with KIR and SLC11A1 polymorphisms, ethnic predisposition and influence in clinical manifestations at onset revealed by ancestry genetic markers in an urban Brazilian population.Lupus. 2011 Mar;20(3):265-73. doi: 10.1177/0961203310385266. Epub 2011 Jan 13.
14 HLA-Cw polypmorphism and killer cell immunoglobulin-like receptor (KIR) gene analysis in Korean colorectal cancer patients.Int J Surg. 2014;12(8):815-20. doi: 10.1016/j.ijsu.2014.06.012. Epub 2014 Jul 4.
15 Activating KIR2DS5 receptor is a risk for thyroid cancer.Hum Immunol. 2012 Oct;73(10):1017-22. doi: 10.1016/j.humimm.2012.07.325. Epub 2012 Jul 23.
16 Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
17 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.