Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYLL6GM)

DOT Name Fibrous sheath-interacting protein 1 (FSIP1)
Gene Name FSIP1
Related Disease
Advanced cancer ( )
Amyloidosis ( )
Asthma ( )
Ataxia-telangiectasia ( )
Bladder cancer ( )
Bone cancer ( )
Breast neoplasm ( )
Colorectal carcinoma ( )
HSD10 mitochondrial disease ( )
Lung cancer ( )
Lung carcinoma ( )
Metastatic malignant neoplasm ( )
Multiple sclerosis ( )
Non-small-cell lung cancer ( )
Parkinson disease ( )
Pheochromocytoma ( )
Triple negative breast cancer ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Bladder transitional cell carcinoma ( )
Breast cancer ( )
Breast carcinoma ( )
Intellectual disability ( )
Neoplasm ( )
UniProt ID
FSIP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15554
Sequence
MDIIKGNLDGISKPASNSRIRPGSRSSNASLEVLSTEPGSFKVDTASNLNSGKEDHSESS
NTENRRTSNDDKQESCSEKIKLAEEGSDEDLDLVQHQIISECSDEPKLKELDSQLQDAIQ
KMKKLDKILAKKQRREKEIKKQGLEMRIKLWEEIKSAKYSEAWQSKEEMENTKKFLSLTA
VSEETVGPSHEEEDTFSSVFHTQIPPEEYEMQMQKLNKDFTCDVERNESLIKSGKKPFSN
TEKIELRGKHNQDFIKRNIELAKESRNPVVMVDREKKRLVELLKDLDEKDSGLSSSEGDQ
SGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPTISSFSPRLENRNNQKPDRDGERNM
EVTPGEKILRNTKEQRDLHNRLREIDEKLKMMKENVLESTSCLSEEQLKCLLDECILKQK
SIIKLSSERKKEDIEDVTPVFPQLSRSIISKLLNESETKVQKTEVEDADMLESEECEASK
GYYLTKALTGHNMSEALVTEAENMKCLQFSKDVIISDTKDYFMSKTLGIGRLKRPSFLDD
PLYGISVSLSSEDQHLKLSSPENTIADEQETKDAAEECKEP

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Amyloidosis DISHTAI2 Strong Biomarker [2]
Asthma DISW9QNS Strong Genetic Variation [3]
Ataxia-telangiectasia DISP3EVR Strong Genetic Variation [3]
Bladder cancer DISUHNM0 Strong Altered Expression [4]
Bone cancer DIS38NA0 Strong Altered Expression [5]
Breast neoplasm DISNGJLM Strong Altered Expression [6]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [7]
HSD10 mitochondrial disease DISCJYFW Strong Genetic Variation [8]
Lung cancer DISCM4YA Strong Biomarker [9]
Lung carcinoma DISTR26C Strong Biomarker [9]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [10]
Multiple sclerosis DISB2WZI Strong Biomarker [11]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [9]
Parkinson disease DISQVHKL Strong Altered Expression [5]
Pheochromocytoma DIS56IFV Strong Biomarker [5]
Triple negative breast cancer DISAMG6N Strong Biomarker [12]
Urinary bladder cancer DISDV4T7 Strong Altered Expression [4]
Urinary bladder neoplasm DIS7HACE Strong Altered Expression [4]
Bladder transitional cell carcinoma DISNL46A moderate Altered Expression [4]
Breast cancer DIS7DPX1 Limited Biomarker [1]
Breast carcinoma DIS2UE88 Limited Biomarker [1]
Intellectual disability DISMBNXP Limited Genetic Variation [13]
Neoplasm DISZKGEW Limited Altered Expression [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 24 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Fibrous sheath-interacting protein 1 (FSIP1) increases the response to substance of Arsenic. [21]
Aspirin DM672AH Approved Fibrous sheath-interacting protein 1 (FSIP1) affects the response to substance of Aspirin. [3]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Fibrous sheath-interacting protein 1 (FSIP1). [14]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Fibrous sheath-interacting protein 1 (FSIP1). [19]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Fibrous sheath-interacting protein 1 (FSIP1). [15]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Fibrous sheath-interacting protein 1 (FSIP1). [16]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Fibrous sheath-interacting protein 1 (FSIP1). [17]
Cytarabine DMZD5QR Approved Cytarabine increases the expression of Fibrous sheath-interacting protein 1 (FSIP1). [18]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Fibrous sheath-interacting protein 1 (FSIP1). [20]
------------------------------------------------------------------------------------

References

1 FSIP1 is correlated with estrogen receptor status and poor prognosis.Mol Carcinog. 2020 Jan;59(1):126-135. doi: 10.1002/mc.23134. Epub 2019 Nov 12.
2 Roles of Mitochondrial 17-Hydroxysteroid Dehydrogenase Type 10 in Alzheimer's Disease.J Alzheimers Dis. 2018;62(2):665-673. doi: 10.3233/JAD-170974.
3 Positive association between aspirin-intolerant asthma and genetic polymorphisms of FSIP1: a case-case study. BMC Pulm Med. 2010 Jun 1;10:34. doi: 10.1186/1471-2466-10-34.
4 Knockdown of fibrous sheath interacting protein 1 expression reduces bladder urothelial carcinoma cell proliferation and induces apoptosis via inhibition of the PI3K/AKT pathway.Onco Targets Ther. 2018 Apr 5;11:1961-1971. doi: 10.2147/OTT.S158275. eCollection 2018.
5 Overexpression of 17-hydroxysteroid dehydrogenase type 10 increases pheochromocytoma cell growth and resistance to cell death.BMC Cancer. 2015 Mar 22;15:166. doi: 10.1186/s12885-015-1173-5.
6 Elevated expression of cancer/testis antigen FSIP1 in ER-positive breast tumors.Biomark Med. 2013 Aug;7(4):601-11. doi: 10.2217/bmm.13.58.
7 17-Hydroxysteroid dehydrogenase type 10 predicts survival of patients with colorectal cancer and affects mitochondrial DNA content.Cancer Lett. 2016 Apr 28;374(1):149-155. doi: 10.1016/j.canlet.2016.02.011. Epub 2016 Feb 13.
8 A novel mutation in the HSD17B10 gene of a 10-year-old boy with refractory epilepsy, choreoathetosis and learning disability.PLoS One. 2011;6(11):e27348. doi: 10.1371/journal.pone.0027348. Epub 2011 Nov 22.
9 Elevated fibrous sheath interacting protein 1 levels are associated with poor prognosis in non-small cell lung cancer patients.Oncotarget. 2017 Feb 14;8(7):12186-12193. doi: 10.18632/oncotarget.14575.
10 Over-expression of FSIP1 promotes breast cancer progression and confers resistance to docetaxel via MRP1 stabilization.Cell Death Dis. 2019 Feb 27;10(3):204. doi: 10.1038/s41419-018-1248-8.
11 Levels of 17-hydroxysteroid dehydrogenase type 10 in CSF are not a valuable biomarker for multiple sclerosis.Biomark Med. 2018 Dec;12(12):1331-1340. doi: 10.2217/bmm-2018-0061. Epub 2018 Dec 6.
12 FSIP1 regulates autophagy in breast cancer.Proc Natl Acad Sci U S A. 2018 Dec 18;115(51):13075-13080. doi: 10.1073/pnas.1809681115. Epub 2018 Dec 3.
13 Hydroxysteroid (17) dehydrogenase X in human health and disease.Mol Cell Endocrinol. 2011 Aug 22;343(1-2):1-6. doi: 10.1016/j.mce.2011.06.011. Epub 2011 Jun 25.
14 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
15 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
16 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
17 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
18 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
19 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
20 Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
21 SLC39A2 and FSIP1 polymorphisms as potential modifiers of arsenic-related bladder cancer. Hum Genet. 2012 Mar;131(3):453-61. doi: 10.1007/s00439-011-1090-x. Epub 2011 Sep 25.
22 Positive association between aspirin-intolerant asthma and genetic polymorphisms of FSIP1: a case-case study. BMC Pulm Med. 2010 Jun 1;10:34. doi: 10.1186/1471-2466-10-34.