Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ19I59)

• DOT Name: Selenide, water dikinase 1 (SEPHS1)
• Synonyms: EC 2.7.9.3; Selenium donor protein 1; Selenophosphate synthase 1
• Gene Name: SEPHS1
• Related Disease:
  Lung cancer
  Lung carcinoma
  Anxiety
  Anxiety disorder
  Colorectal carcinoma
  Crohn disease
  Depression
  High blood pressure
  Hyperparathyroidism
  Neoplasm
  Social phobia
  Coxopodopatellar syndrome
  Psychotic disorder
  Schizophrenia
• UniProt ID: SPS1_HUMAN
• PDB ID: 3FD5; 3FD6
• EC Number: 2.7.9.3
• Pfam ID: PF00586 ; PF02769
• Sequence:
  MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAV
  MPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECD
  NMLMLLGVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVC
  QPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
  MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMA
  AVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKG
  NRTARIIDKPRIIEVAPQVATQNVNPTPGATS
• Function: Synthesizes selenophosphate from selenide and ATP.
• Tissue Specificity: .Gradually expressed during the cell cycle until G2/M phase and then decreases.; [Isoform 2]: Gradually expressed during the cell cycle until G2/M phase and then decreases.; [Isoform 3]: Gradually expressed during the cell cycle until S phase and then decreases.
• KEGG Pathway:
  Selenocompound metabolism (hsa00450)
  Metabolic pathways (hsa01100)

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Definitive	Biomarker	[1]
Lung carcinoma	DISTR26C	Definitive	Biomarker	[1]
Anxiety	DISIJDBA	Strong	Biomarker	[2]
Anxiety disorder	DISBI2BT	Strong	Biomarker	[2]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[3]
Crohn disease	DIS2C5Q8	Strong	Genetic Variation	[4]
Depression	DIS3XJ69	Strong	Biomarker	[5]
High blood pressure	DISY2OHH	Strong	Biomarker	[6]
Hyperparathyroidism	DIS4FVAT	Strong	Biomarker	[7]
Neoplasm	DISZKGEW	Strong	Biomarker	[3]
Social phobia	DISQGN78	Strong	Biomarker	[8]
Coxopodopatellar syndrome	DISMJAT7	Limited	Biomarker	[9]
Psychotic disorder	DIS4UQOT	Limited	Biomarker	[10]
Schizophrenia	DISSRV2N	Limited	Biomarker	[10]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Selenide, water dikinase 1 (SEPHS1) affects the response to substance of Fluorouracil.	[26]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Selenide, water dikinase 1 (SEPHS1).	[11]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Selenide, water dikinase 1 (SEPHS1).	[12]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Selenide, water dikinase 1 (SEPHS1).	[13]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Selenide, water dikinase 1 (SEPHS1).	[14]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Selenide, water dikinase 1 (SEPHS1).	[15]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Selenide, water dikinase 1 (SEPHS1).	[16]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Selenide, water dikinase 1 (SEPHS1).	[14]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Selenide, water dikinase 1 (SEPHS1).	[17]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Selenide, water dikinase 1 (SEPHS1).	[18]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Selenide, water dikinase 1 (SEPHS1).	[19]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Selenide, water dikinase 1 (SEPHS1).	[20]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Selenide, water dikinase 1 (SEPHS1).	[21]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Selenide, water dikinase 1 (SEPHS1).	[22]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Selenide, water dikinase 1 (SEPHS1).	[23]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Selenide, water dikinase 1 (SEPHS1).	[25]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Selenide, water dikinase 1 (SEPHS1).	[24]

References

• [1] Chemical identification of a sulfated glucan from Antrodia cinnamomea and its anti-cancer functions via inhibition of EGFR and mTOR activity.Carbohydr Polym. 2018 Dec 15;202:536-544. doi: 10.1016/j.carbpol.2018.09.009. Epub 2018 Sep 6.
• [2] Single prolonged stress PTSD model triggers progressive severity of anxiety, altered gene expression in locus coeruleus and hypothalamus and effected sensitivity to NPY.Eur Neuropsychopharmacol. 2019 Apr;29(4):482-492. doi: 10.1016/j.euroneuro.2019.02.010. Epub 2019 Mar 14.
• [3] Glucuronorhamnoxylan from Capsosiphon fulvescens inhibits the growth of HT-29 human colon cancer cells in vitro and in vivo via induction of apoptotic cell death.Int J Biol Macromol. 2019 Mar 1;124:1060-1068. doi: 10.1016/j.ijbiomac.2018.12.001. Epub 2018 Dec 3.
• [4] Selenium, selenoprotein genes and Crohn's disease in a case-control population from Auckland, New Zealand.Nutrients. 2012 Sep;4(9):1247-59. doi: 10.3390/nu4091247. Epub 2012 Sep 7.
• [5] Factors Associated With Presenteeism at Work in Type 2 Diabetes Mellitus.J Occup Environ Med. 2018 Dec;60(12):1116-1119. doi: 10.1097/JOM.0000000000001446.
• [6] Development of WNK signaling inhibitors as a new class of antihypertensive drugs.Bioorg Med Chem. 2017 Jul 15;25(14):3845-3852. doi: 10.1016/j.bmc.2017.05.034. Epub 2017 May 19.
• [7] Compared effects of calcium and sodium polystyrene sulfonate on mineral and bone metabolism and volume overload in pre-dialysis patients with hyperkalemia.Clin Exp Nephrol. 2018 Feb;22(1):35-44. doi: 10.1007/s10157-017-1412-y. Epub 2017 Apr 18.
• [8] Factors associated with social anxiety in South Korean adults with epilepsy.Epilepsy Behav. 2019 Dec;101(Pt A):106569. doi: 10.1016/j.yebeh.2019.106569. Epub 2019 Oct 30.
• [9] Spatial and temporal regulation of the endoproteolytic activity of the SPS-sensor-controlled Ssy5 signaling protease.Mol Biol Cell. 2019 Oct 1;30(21):2709-2720. doi: 10.1091/mbc.E19-02-0096. Epub 2019 Aug 28.
• [10] Sex-specific rates of transmission of psychosis in the New England high-risk family study.Schizophr Res. 2011 May;128(1-3):150-5. doi: 10.1016/j.schres.2011.01.019. Epub 2011 Feb 18.
• [11] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [12] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [13] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [14] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [15] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [16] A genomic approach to predict synergistic combinations for breast cancer treatment. Pharmacogenomics J. 2013 Feb;13(1):94-104. doi: 10.1038/tpj.2011.48. Epub 2011 Nov 15.
• [17] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [18] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [19] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [20] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [21] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [22] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [23] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [24] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [25] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [26] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.