Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZO94EO)

• DOT Name: Iduronate 2-sulfatase (IDS)
• Synonyms: EC 3.1.6.13; Alpha-L-iduronate sulfate sulfatase; Idursulfase
• Gene Name: IDS
• Related Disease:
  Mucopolysaccharidosis II
  Mucopolysaccharidosis type 2, attenuated form
  Mucopolysaccharidosis type 2, severe form
• UniProt ID: IDS_HUMAN
• PDB ID: 5FQL; 6IOZ
• EC Number: 3.1.6.13
• Pfam ID: PF00884
• Sequence:
  MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVR
  SPNIDQLASHSLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIP
  QYFKENGYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHA
  NLLCPVDVLDVPEGTLPDKQSTEQAIQLLEKMKTSASPFFLAVGYHKPHIPFRYPKEFQK
  LYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQRKIRQSY
  FASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSNFDVATHVPLI
  FYVPGRTASLPEAGEKLFPYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPP
  RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKP
  SLKDIKIMGYSIRTIDYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQ
  GGDLFQLLMP
• Function: Lysosomal enzyme involved in the degradation pathway of dermatan sulfate and heparan sulfate.
• Tissue Specificity: Liver, kidney, lung, and placenta.
• KEGG Pathway:
  Glycosaminoglycan degradation (hsa00531)
  Metabolic pathways (hsa01100)
  Lysosome (hsa04142)
• Reactome Pathway:
  CS/DS degradation (R-HSA-2024101)
  MPS II - Hunter syndrome (R-HSA-2206296)
  HS-GAG degradation (R-HSA-2024096)
• BioCyc Pathway: MetaCyc:HS00286-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Mucopolysaccharidosis II	DIS87GLG	Definitive	X-linked	[1]
Mucopolysaccharidosis type 2, attenuated form	DISS1E36	Supportive	X-linked	[2]
Mucopolysaccharidosis type 2, severe form	DIS6SBPF	Supportive	X-linked	[2]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Iduronate 2-sulfatase (IDS).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Iduronate 2-sulfatase (IDS).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Iduronate 2-sulfatase (IDS).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Iduronate 2-sulfatase (IDS).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Iduronate 2-sulfatase (IDS).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Iduronate 2-sulfatase (IDS).	[8]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Iduronate 2-sulfatase (IDS).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Iduronate 2-sulfatase (IDS).	[10]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Iduronate 2-sulfatase (IDS).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Iduronate 2-sulfatase (IDS).	[12]
Marinol	DM70IK5	Approved	Marinol increases the expression of Iduronate 2-sulfatase (IDS).	[13]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Iduronate 2-sulfatase (IDS).	[14]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Iduronate 2-sulfatase (IDS).	[15]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Iduronate 2-sulfatase (IDS).	[16]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Iduronate 2-sulfatase (IDS).	[17]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Iduronate 2-sulfatase (IDS).	[8]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of Iduronate 2-sulfatase (IDS).	[8]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Iduronate 2-sulfatase (IDS).	[8]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Iduronate 2-sulfatase (IDS).	[8]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Iduronate 2-sulfatase (IDS).	[18]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Iduronate 2-sulfatase (IDS).	[19]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Iduronate 2-sulfatase (IDS).	[20]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Iduronate 2-sulfatase (IDS).	[21]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Iduronate 2-sulfatase (IDS).	[15]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of Iduronate 2-sulfatase (IDS).	[22]
PP-242	DM2348V	Investigative	PP-242 decreases the expression of Iduronate 2-sulfatase (IDS).	[23]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Clinical Practice Guidelines for Rare Diseases: The Orphanet Database. PLoS One. 2017 Jan 18;12(1):e0170365. doi: 10.1371/journal.pone.0170365. eCollection 2017.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [5] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [9] Analysis of estrogen agonism and antagonism of tamoxifen, raloxifene, and ICI182780 in endometrial cancer cells: a putative role for the epidermal growth factor receptor ligand amphiregulin. J Soc Gynecol Investig. 2005 Oct;12(7):e55-67.
• [10] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [11] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [12] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [13] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [14] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [15] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [16] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [17] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [18] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [19] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [20] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [21] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [22] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [23] Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.