Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTPFTEQ)

• DTP Name: Organic anion transporting polypeptide 2B1 (SLCO2B1)
• Gene Name: SLCO2B1
• UniProt ID: O94956 (SO2B1_HUMAN)
• VARIDT ID: DTD0031
• Synonyms: KIAA0880; OATP-B; OATP-RP2; OATP2B1; OATPB; OATPRP2; Organic anion transporter B; Organic anion transporter polypeptide-related protein 2; SLC21A9; SLCO2B1; Solute carrier family 21 member 9; Solute carrier organic anion transporter family member 2B1
• DTP Family: Organo Anion Transporter (OAT) Family
• Tissue Specificity: Isoform 1 has it's highest expression inbrain, it is the major form expressed in duodenum, kidney,placenta, and skeletal muscle. Isoform 3 predominates in liver.
• Sequence:
  MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQL
  AQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGY
  GAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSY
  TETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGL
  AFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKE
  MPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVF
  PRVLLQTLRHPIFLLVVLSQVCLSSMAAGMAIFLPKFLERQFSITASYANLLIGCLSFPS
  VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAH
  PGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCS
  CVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVG
  IQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKT
  GSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV
• Function: This Na(+)-independent transporter mediates the transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.
• Endogenous Substrate(s): Organoanions
• TCDB ID: 2.A.60.1.20
• Gene ID: 11309
• Reactome Pathway:
  Transport of organic anions (R-HSA-879518)
  Aspirin ADME (R-HSA-9749641)
  Atorvastatin ADME (R-HSA-9754706)
  Heme degradation (R-HSA-189483)

Molecular Interaction Atlas (MIA) of This DTP

29 Approved Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Abiraterone acetate	DMANBZI	Prostate cancer	2C82.0	Approved	[2]
Aliskiren	DM1BV7W	Hypertension	BA00-BA04	Approved	[3]
Atorvastatin	DMF28YC	Acute coronary syndrome	BA41	Approved	[4]
BOL-303259-X	DM2EXC5	Open-angle glaucoma	9C61	Approved	[5]
Bosentan	DMIOGBU	Pulmonary arterial hypertension	BB01.0	Approved	[6]
Cerivastatin	DMXCM7H	Hyperlipidaemia	5C80	Approved	[7]
Dehydroepiandrosterone sulfate	DM4Q80H	N. A.	N. A.	Approved	[8]
Digoxin	DMQCTIH	Arrhythmia	BC9Z	Approved	[9]
Dinoprostone	DMTYOPD	Medical abortion	JA00.1Z	Approved	[10]
Eltrombopag	DMOGFIX	Thrombocytopenia	3B64	Approved	[11]
Estrone sulfate	DMVBIZL	Atrophic vaginitis	GA30.2	Approved	[12]
Etoposide	DMNH3PG	Acute myelogenous leukaemia	2A41	Approved	[13]
Fexofenadine	DM17ONX	Allergic rhinitis	CA08.0	Approved	[14]
Fluvastatin	DM4MDJY	Arteriosclerosis	BD40	Approved	[12]
Glibenclamide	DM8JXPZ	Diabetic complication	5A2Y	Approved	[15]
L-Glutamic Acid	DM4PUDW	Schizophrenia	6A20	Approved	[16]
Latanoprost	DMI5OXG	Ocular hypertension	9C61.01	Approved	[5]
lifitegrast	DM4WVC5	Dry eye disease	9E1Z	Approved	[17]
Mesalazine	DMOL5IU	Diverticulitis		Approved	[18]
Montelukast	DMD157S	Allergic asthma	CA23.0	Approved	[19]
Pemetrexed	DMMX2E6	Central nervous system lymphoma	2B33.5	Approved	[20]
Pitavastatin	DMJH792	Hypercholesterolaemia	5C80.0	Approved	[21]
PITAVASTATIN CALCIUM	DM1UJO0	Dyslipidemia	5C80-5C81	Approved	[22]
Pravastatin	DM6A0X7	Adult acute monocytic leukemia		Approved	[23]
Ritonavir	DMU764S	Human immunodeficiency virus infection	1C62	Approved	[24]
Rocuronium	DMY9BMK	Muscle spasm	MB47.3	Approved	[9]
Rosuvastatin	DMMIQ7G	Arteriosclerosis	BD40	Approved	[25]
Sulfasalazine	DMICA9H	Irritable bowel syndrome	DD91.0	Approved	[26]
Telmisartan	DMS3GX2	Hypertension	BA00-BA04	Approved	[27]

4 Clinical Trial Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alilusem	DM9R2SD	Diuretic vasodilator	BA00	Phase 3	[28]
Benzylpenicillin	DMS9503	Actinomycosis		Phase 3	[10]
Sodium taurocholate	DM3GO0J	Type-2 diabetes	5A11	Phase 1/2	[23]
Taurocholic Acid	DM2LZ8F	Type-2 diabetes	5A11	Phase 1/2	[23]

1 Preclinical Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Scutellarin	DMJT1E5	N. A.	N. A.	Preclinical	[29]

2 Investigative Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
bromsulphthalein	DM9W2ZV	N. A.	N. A.	Investigative	[30]
talinolol	DMRTD16	Discovery agent	N.A.	Investigative	[31]

Molecular Expression Atlas (MEA) of This DTP

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	1.87E-02	-1.32E-01	-2.75E-01
Adrenocortical carcinoma	2D11.Z	Kidney	1.77E-02	-3.35E-01	-8.96E-01
Alopecia	ED70	Skin from scalp	7.31E-02	-1.85E-01	-6.06E-01
Alzheimer's disease	8A20	Entorhinal cortex	6.30E-05	2.52E-01	5.88E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	7.43E-01	7.48E-02	1.75E-01
Aortic stenosis	BB70	Calcified aortic valve	6.53E-02	3.23E-01	1.05E+00
Apnea	7A40	Hyperplastic tonsil	3.79E-03	5.39E-01	1.60E+00
Arthropathy	FA00-FA5Z	Peripheral blood	2.38E-01	1.54E-01	6.44E-01
Asthma	CA23	Nasal and bronchial airway	1.75E-01	-5.73E-02	-1.09E-01
Atopic dermatitis	EA80	Skin	6.41E-01	-6.01E-02	-2.45E-01
Autism	6A02	Whole blood	1.98E-01	1.02E-01	3.95E-01
Autoimmune uveitis	9A96	Peripheral monocyte	3.00E-01	-2.64E-01	-1.37E+00
Autosomal dominant monocytopenia	4B04	Whole blood	5.07E-01	-6.44E-02	-5.61E-01
Bacterial infection of gingival	1C1H	Gingival tissue	1.19E-10	4.96E-01	1.15E+00
Batten disease	5C56.1	Whole blood	6.65E-01	1.17E-01	8.36E-01
Behcet's disease	4A62	Peripheral blood	9.85E-01	1.34E-02	4.85E-02
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	9.32E-02	-4.70E-02	-2.54E-01
Bladder cancer	2C94	Bladder tissue	2.63E-01	2.32E-01	8.26E-01
Breast cancer	2C60-2C6Z	Breast tissue	3.15E-02	-8.64E-02	-1.24E-01
Cardioembolic stroke	8B11.20	Whole blood	6.82E-03	1.96E-01	9.10E-01
Cervical cancer	2C77	Cervical tissue	1.16E-01	-6.43E-03	-2.29E-02
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	7.27E-01	5.21E-02	1.98E-01
Chronic hepatitis C	1E51.1	Whole blood	4.75E-01	1.06E-01	5.56E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	7.04E-01	-3.92E-02	-6.23E-02
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	7.84E-03	1.76E-01	3.99E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	5.99E-01	-1.54E-01	-6.96E-01
Colon cancer	2B90	Colon tissue	1.83E-15	-4.13E-01	-8.37E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	2.20E-01	8.44E-02	6.28E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	9.31E-01	4.39E-02	1.76E-01
Endometriosis	GA10	Endometrium tissue	9.36E-02	2.93E-01	6.06E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	8.59E-01	1.44E-02	9.24E-02
Familial hypercholesterolemia	5C80.00	Whole blood	3.80E-01	-1.23E-02	-5.33E-02
Gastric cancer	2B72	Gastric tissue	1.94E-01	1.99E-01	4.30E-01
Glioblastopma	2A00.00	Nervous tissue	1.91E-01	-2.69E-01	-3.77E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	2.96E-01	1.22E-01	2.50E-01
Head and neck cancer	2D42	Head and neck tissue	9.40E-19	7.62E-01	1.33E+00
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	8.26E-02	9.08E-02	4.17E-01
Huntington's disease	8A01.10	Whole blood	6.34E-01	3.66E-02	3.71E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	5.94E-01	4.28E-01	6.73E-01
Immunodeficiency	4A00-4A20	Peripheral blood	1.77E-01	-7.68E-02	-7.16E-01
Influenza	1.00E+30	Whole blood	1.47E-01	2.43E-01	1.99E+00
Interstitial cystitis	GC00.3	Bladder tissue	8.97E-05	8.92E-01	4.47E+00
Intracranial aneurysm	8B01.0	Intracranial artery	1.71E-04	1.55E+00	5.55E+00
Irritable bowel syndrome	DD91.0	Rectal colon tissue	1.15E-01	-3.75E-02	-2.01E-01
Ischemic stroke	8B11	Peripheral blood	6.68E-01	-1.39E-02	-6.56E-02
Juvenile idiopathic arthritis	FA24	Peripheral blood	1.70E-01	4.66E-02	1.84E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	5.43E-01	-1.66E-01	-3.64E-01
Lateral sclerosis	8B60.4	Skin	1.94E-01	2.31E-01	9.97E-01
Liver cancer	2C12.0	Liver tissue	4.73E-11	-1.18E+00	-1.33E+00
Liver failure	DB99.7-DB99.8	Liver tissue	4.32E-01	-1.70E-01	-2.75E-01
Lung cancer	2C25	Lung tissue	4.25E-42	-1.06E+00	-1.48E+00
Lupus erythematosus	4A40	Whole blood	1.10E-02	-1.45E-01	-2.46E-01
Major depressive disorder	6A70-6A7Z	Whole blood	4.16E-01	3.60E-04	1.39E-03
Major depressive disorder	6A70-6A7Z	Hippocampus	8.63E-01	8.34E-03	4.64E-02
Melanoma	2C30	Skin	5.96E-04	1.02E+00	9.70E-01
Multiple myeloma	2A83.1	Bone marrow	1.70E-02	-1.23E+00	-1.37E+00
Multiple myeloma	2A83.1	Peripheral blood	4.78E-01	9.86E-02	7.44E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	4.22E-01	2.80E-01	6.45E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	1.79E-02	2.68E-01	5.04E-01
Myelofibrosis	2A20.2	Whole blood	2.18E-03	3.73E-02	2.60E-01
Myocardial infarction	BA41-BA50	Peripheral blood	1.98E-02	4.50E-01	8.10E-01
Myopathy	8C70.6	Muscle tissue	3.62E-04	7.99E-01	3.47E+00
Neonatal sepsis	KA60	Whole blood	7.95E-07	1.79E-01	6.91E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	2.01E-07	-1.60E+00	-4.28E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	9.55E-01	3.89E-01	6.60E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	2.03E-01	1.87E-01	1.00E+00
Olive pollen allergy	CA08.00	Peripheral blood	9.13E-02	3.92E-01	1.10E+00
Oral cancer	2B6E	Oral tissue	8.99E-01	-1.04E-01	-2.52E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	7.40E-01	-1.98E-01	-4.23E-01
Osteoporosis	FB83.1	Bone marrow	9.98E-02	1.08E-01	1.51E+00
Ovarian cancer	2C73	Ovarian tissue	6.49E-01	1.52E-01	2.84E-01
Pancreatic cancer	2C10	Pancreas	8.32E-03	5.28E-01	8.47E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	7.68E-01	-7.76E-02	-1.74E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	8.57E-01	4.56E-02	1.85E-01
Pituitary cancer	2D12	Pituitary tissue	6.71E-03	4.41E-01	1.24E+00
Pituitary gonadotrope tumour	2D12	Pituitary tissue	1.74E-02	4.26E-01	2.06E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	6.30E-01	2.54E-02	2.80E-01
Polycythemia vera	2A20.4	Whole blood	1.74E-05	1.62E-01	1.20E+00
Pompe disease	5C51.3	Biceps muscle	5.90E-01	9.95E-02	6.10E-01
Preterm birth	KA21.4Z	Myometrium	3.07E-01	-2.52E-01	-8.64E-01
Prostate cancer	2C82	Prostate	2.89E-11	-1.11E+00	-2.81E+00
Psoriasis	EA90	Skin	2.89E-08	-2.65E-01	-4.36E-01
Rectal cancer	2B92	Rectal colon tissue	3.93E-01	-4.86E-02	-2.05E-01
Renal cancer	2C90-2C91	Kidney	2.15E-02	2.14E-01	5.32E-01
Retinoblastoma	2D02.2	Uvea	2.75E-03	6.30E-01	2.29E+00
Rheumatoid arthritis	FA20	Synovial tissue	2.74E-06	1.44E+00	5.21E+00
Rhinovirus infection	CA42.1	Nasal epithelium tissue	5.30E-01	-1.08E-02	-6.20E-02
Schizophrenia	6A20	Prefrontal cortex	5.69E-01	-7.65E-02	-1.26E-01
Schizophrenia	6A20	Superior temporal cortex	1.20E-01	1.56E-01	7.82E-01
Scleroderma	4A42.Z	Whole blood	4.02E-01	8.46E-02	4.34E-01
Seizure	8A60-8A6Z	Whole blood	8.88E-01	-1.21E-01	-6.10E-01
Sensitive skin	EK0Z	Skin	4.88E-01	6.76E-02	1.86E-01
Sepsis with septic shock	1G41	Whole blood	7.65E-15	2.04E-01	7.80E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	2.27E-01	6.11E-01	1.20E+00
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	1.33E-01	5.42E-02	2.41E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	5.43E-01	-8.74E-02	-4.40E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	4.97E-01	1.34E-03	6.34E-03
Skin cancer	2C30-2C3Z	Skin	5.77E-01	-1.87E-01	-2.72E-01
Thrombocythemia	3B63	Whole blood	3.36E-04	8.87E-02	6.61E-01
Thrombocytopenia	3B64	Whole blood	1.68E-01	-3.34E-02	-2.12E-01
Thyroid cancer	2D10	Thyroid	9.51E-02	8.35E-02	1.63E-01
Tibial muscular dystrophy	8C75	Muscle tissue	5.92E-09	5.52E-01	3.28E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	7.87E-01	-1.36E-01	-8.58E-01
Type 2 diabetes	5A11	Liver tissue	4.61E-01	-7.46E-02	-2.18E-01
Ureter cancer	2C92	Urothelium	7.79E-01	4.21E-04	1.90E-03
Uterine cancer	2C78	Endometrium tissue	4.37E-06	-3.34E-01	-9.63E-01
Vitiligo	ED63.0	Skin	6.84E-02	-2.26E-01	-7.27E-01

Drug Affinity of This DTP Assessed by Cell Line

Approved Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Atorvastatin	Approved	Human embryonic kidney cells (HEK293)-OATP2B1	Km = 2.84 microM	[32]
Atorvastatin	Approved	Madin-Darby canine kidney cells (MDCKII)-OATP2B1	Km = 0.2 microM	[33]
Bosentan	Approved	Chinese hamster ovary (CHO) cells-OATP2B1	Km = 202.0 microM	[6]
Fluvastatin	Approved	Human embryonic kidney cells (HEK293)-OATP2B1	Km = 0.75 microM	[12]
Glibenclamide	Approved	Human embryonic kidney cells (HEK293)-OATP2B1	Km = 6.26 microM	[15]
Mesalazine	Approved	Human embryonic kidney cells (HEK293)-OATP2B1	Km = 188.9 microM	[18]
PITAVASTATIN CALCIUM	Approved	Human embryonic kidney cells (HEK293)-OATP2B1	Km = 1.17 microM	[22]
Pravastatin	Approved	Human embryonic kidney cells (HEK293)-OATP2B1	Km = 2250.0 microM	[23]
Rosuvastatin	Approved	Human cervical cancer cell line (Hela)-OATP2B1	Km = 2.4 microM	[34]
Rosuvastatin	Approved	Human embryonic kidney cells (HEK293)-OATP2B1	Km = 6.42 microM	[25]
Telmisartan	Approved	Human embryonic kidney cells (HEK293)-OATP2B1	Km = 1.09 microM	[27]

Clinical Trial Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
Sodium taurocholate	Phase 1/2	Human embryonic kidney cells (HEK293)-OATP2B1	Km = 71.8 microM	[23]
Taurocholic Acid	Phase 1/2	Human embryonic kidney cells (HEK293)-OATP2B1	Km = 71.8 microM	[23]

Investigative Drug(s)

Drug Name	Highest Status	Cell Line	Affinity	REF
bromsulphthalein	Investigative	Oocytes-OATP2B1	Km = 0.7 microM	[35]

The Drug Therapeutic Target (DTT) Role of This DTP

• DTP DTT Name: Organic anion transporter B (SLCO2B1) DTT Info
• DTP DTT Type: Literature-reported

1 Investigative Drug(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
[3H]estrone-3-sulphate	DMGPF0N	Discovery agent	N.A.	Investigative	[1]

References

• [1] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1224).
• [2] The impact of statin use on the efficacy of abiraterone acetate in patients with castration-resistant prostate cancer. Prostate. 2017 May;77(13):1303-1311.
• [3] Orange and apple juice greatly reduce the plasma concentrations of the OATP2B1 substrate aliskiren. Br J Clin Pharmacol. 2011 May;71(5):718-26.
• [4] Human platelets express organic anion-transporting peptide 2B1, an uptake transporter for atorvastatin. Drug Metab Dispos. 2009 May;37(5):1129-37.
• [5] The prostaglandin transporter OATP2A1 is expressed in human ocular tissues and transports the antiglaucoma prostanoid latanoprost. Invest Ophthalmol Vis Sci. 2010 May;51(5):2504-11.
• [6] Bosentan is a substrate of human OATP1B1 and OATP1B3: inhibition of hepatic uptake as the common mechanism of its interactions with cyclosporin A, rifampicin, and sildenafil. Drug Metab Dispos. 2007 Aug;35(8):1400-7.
• [7] pH-sensitive interaction of HMG-CoA reductase inhibitors (statins) with organic anion transporting polypeptide 2B1. Mol Pharm. 2011 Aug 1;8(4):1303-13.
• [8] Expression of OATP family members in hormone-related cancers: potential markers of progression. PLoS One. 2011;6(5):e20372.
• [9] Drug Interactions in Infectious Diseases.
• [10] Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family. Biochem Biophys Res Commun. 2000 Jun 24;273(1):251-60.
• [11] Pharmacokinetics and hepatic uptake of eltrombopag, a novel platelet-increasing agent. Drug Metab Dispos. 2011 Jun;39(6):1088-96.
• [12] Substrate-dependent drug-drug interactions between gemfibrozil, fluvastatin and other organic anion-transporting peptide (OATP) substrates on OATP1B1, OATP2B1, and OATP1B3. Drug Metab Dispos. 2007 Aug;35(8):1308-14.
• [13] Identification of drugs and drug metabolites as substrates of multidrug resistance protein 2 (MRP2) using triple-transfected MDCK-OATP1B1-UGT1A1-MRP2 cells. Br J Pharmacol. 2012 Mar;165(6):1836-1847.
• [14] The effects of the SLCO2B1 c.1457C>T polymorphism and apple juice on the pharmacokinetics of fexofenadine and midazolam in humans. Pharmacogenet Genomics. 2011 Feb;21(2):84-93.
• [15] Citrus juices inhibit the function of human organic anion-transporting polypeptide OATP-B. Drug Metab Dispos. 2005 Apr;33(4):518-23.
• [16] The Transporter Classification Database (TCDB): recent advances. Nucleic Acids Res. 2016 Jan 4;44(D1):D372-9. (ID: 2.A.60.1.20)
• [17] Clinical Pharmacology and Biopharmaceutics review(s)
• [18] Role of organic anion-transporting polypeptides for cellular mesalazine (5-aminosalicylic acid) uptake. Drug Metab Dispos. 2011 Jun;39(6):1097-102.
• [19] Effects of polymorphisms of the SLCO2B1 transporter gene on the pharmacokinetics of montelukast in humans. J Clin Pharmacol. 2013 Nov;53(11):1186-93.
• [20] Substrate- and pH-specific antifolate transport mediated by organic anion-transporting polypeptide 2B1 (OATP2B1-SLCO2B1). Mol Pharmacol. 2012 Feb;81(2):134-42.
• [21] Intestinal absorption of HMG-CoA reductase inhibitor pitavastatin mediated by organic anion transporting polypeptide and P-glycoprotein/multidrug resistance 1. Drug Metab Pharmacokinet. 2011;26(2):171-9.
• [22] Drug-drug interaction between pitavastatin and various drugs via OATP1B1. Drug Metab Dispos. 2006 Jul;34(7):1229-36.
• [23] Functional characterization of pH-sensitive organic anion transporting polypeptide OATP-B in human. J Pharmacol Exp Ther. 2004 Feb;308(2):438-45.
• [24] pH dependence of organic anion-transporting polypeptide 2B1 in Caco-2 cells: potential role in antiretroviral drug oral bioavailability and drug-drug interactions. J Pharmacol Exp Ther. 2010 Sep 1;334(3):1009-22.
• [25] Involvement of multiple transporters in the hepatobiliary transport of rosuvastatin. Drug Metab Dispos. 2008 Oct;36(10):2014-23.
• [26] Small-Dosing Clinical Study: Pharmacokinetic, Pharmacogenomic (SLCO2B1 and ABCG2), and Interaction (Atorvastatin and Grapefruit Juice) Profiles of 5 Probes for OATP2B1 and BCRP. J Pharm Sci. 2017 Sep;106(9):2688-2694.
• [27] Establishment of a set of double transfectants coexpressing organic anion transporting polypeptide 1B3 and hepatic efflux transporters for the characterization of the hepatobiliary transport of telmisartan acylglucuronide. Drug Metab Dispos. 2008 Apr;36(4):796-805.
• [28] Characterization of the uptake mechanism for a novel loop diuretic, M17055, in Caco-2 cells: involvement of organic anion transporting polypeptide (OATP)-B. Pharm Res. 2007 Jan;24(1):90-8.
• [29] Mechanistic studies on the absorption and disposition of scutellarin in humans: selective OATP2B1-mediated hepatic uptake is a likely key determinant for its unique pharmacokinetic characteristics. Drug Metab Dispos. 2012 Oct;40(10):2009-20.
• [30] Organic anion-transporting polypeptide (OATP) 2B1 contributes to the cellular uptake of theaflavin. Drug Metab Pharmacokinet. 2017 Apr;32(2):145-150.
• [31] Species difference in the effect of grapefruit juice on intestinal absorption of talinolol between human and rat. J Pharmacol Exp Ther. 2010 Jan;332(1):181-9.
• [32] Classification of inhibitors of hepatic organic anion transporting polypeptides (OATPs): influence of protein expression on drug-drug interactions. J Med Chem. 2012 May 24;55(10):4740-63.
• [33] Organic anion transporting polypeptide 2B1 is a high-affinity transporter for atorvastatin and is expressed in the human heart. Clin Pharmacol Ther. 2006 Dec;80(6):607-20.
• [34] Drug and bile acid transporters in rosuvastatin hepatic uptake: function, expression, and pharmacogenetics. Gastroenterology. 2006 May;130(6):1793-806.
• [35] Organic anion-transporting polypeptide B (OATP-B) and its functional comparison with three other OATPs of human liver. Gastroenterology. 2001 Feb;120(2):525-33.